Dbfetch

ID   AH015324; SV 2; linear; genomic DNA; STD; HUM; 1068 BP.
XX
AC   AH015324; DQ178404-DQ178407;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 6 MHC class II antigen (HLA-DQA1) gene,
DE   HLA-DQA1*0503 variant 1 allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1068
RX   DOI; 10.1111/j.1399-0039.2006.00645.x.
RX   PUBMED; 16866887.
RA   Lee K.W., Jung Y.A., Oh D.H.;
RT   "Four novel human leukocyte antigen-DQA1 alleles identified in the Korean
RT   population";
RL   Tissue Antigens 68(2):167-172(2006).
XX
RN   [2]
RP   1-1068
RA   Lee K.W.;
RT   ;
RL   Submitted (24-AUG-2005) to the INSDC.
RL   Hallym Institute for Genome Application, Hallym University, 896
RL   Pyungchon-Dong, Dongan-Gu, Anyang, Kyungki-Do 431-070, Korea
XX
DR   MD5; 54223b89c97189ea093320648a3242aa.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:77539956, gi:77539957, gi:77539958, gi:77539959, gi:77539955.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1068
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1068
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT   mRNA            join(<1..82,183..431,532..813,914..>1068)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT                   /product="MHC class II antigen"
FT   CDS             join(1..82,183..431,532..813,914..1068)
FT                   /codon_start=1
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT                   /product="MHC class II antigen"
FT                   /protein_id="ABA86856.1"
FT                   /translation="MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPS
FT                   GQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRXFDPQFALTNIAVLKHNLNSLIKRSN
FT                   STAATNEVPEVTVFSKSPVTVGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSF
FT                   LSKSDHSFFKISYLTLLPSSEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCA
FT                   LGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL"
FT   exon            1..82
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT                   /number=1
FT   gap             83..182
FT                   /estimated_length=unknown
FT   exon            183..431
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT                   /number=2
FT   gap             432..531
FT                   /estimated_length=unknown
FT   exon            532..813
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT                   /number=3
FT   gap             814..913
FT                   /estimated_length=unknown
FT   exon            914..1068
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0503 variant 1"
FT                   /number=4
XX
SQ   Sequence 1068 BP; 165 A; 207 C; 192 G; 201 T; 303 other;
     atgatcctaa acaaagctct gatgctgggg gcccttgccc tgaccaccgt gatgagcccc        60
     tgtggaggtg aagacattgt ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnctgaccac gtcgcctctt atggtgtaaa cttgtaccag tcttacggtc cctctggcca       240
     gtacacccat gaatttgatg gagatgagca gttctacgtg gacctgggga ggaaggagac       300
     tgtctggtgt ttgcctgttc tcagacaatt tagannnttt gacccgcaat ttgcactgac       360
     aaacatcgct gtcctaaaac ataacttgaa cagtctgatt aaacgctcca actctaccgc       420
     tgctaccaat gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naggttcctg       540
     aggtcacagt gttttccaag tctcccgtga cagtgggtca gcccaacatc ctcatctgtc       600
     ttgtggacaa catctttcct cctgtggtca acatcacatg gctgagcaat gggcactcag       660
     tcacagaagg tgtttctgag accagcttcc tctccaagag tgatcattcc ttcttcaaga       720
     tcagttacct caccctcctc ccttcttctg aggagagtta tgactgcaag gtggagcact       780
     ggggcctgga caagcctctt ctgaaacact gggnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnagcctga gattccagcc cctatgtcag agctcacaga gactgtggtc       960
     tgcgccctgg gattgtctgt gggcctcgtg ggcattgtgg tgggcactgt cttcatcatc      1020
     cgaggcctgc gttcagttgg tgcttccaga caccaagggc ccttgtga                   1068
//