Dbfetch

ID   AH015323; SV 2; linear; genomic DNA; STD; HUM; 1068 BP.
XX
AC   AH015323; DQ178400-DQ178403;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 6 MHC class II antigen (HLA-DQA1) gene,
DE   HLA-DQA1*010201 allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1068
RX   DOI; 10.1111/j.1399-0039.2006.00645.x.
RX   PUBMED; 16866887.
RA   Lee K.W., Jung Y.A., Oh D.H.;
RT   "Four novel human leukocyte antigen-DQA1 alleles identified in the Korean
RT   population";
RL   Tissue Antigens 68(2):167-172(2006).
XX
RN   [2]
RP   1-1068
RA   Lee K.W.;
RT   ;
RL   Submitted (24-AUG-2005) to the INSDC.
RL   Hallym Institute for Genome Application, Hallym University, 896
RL   Pyungchon-Dong, Dongan-Gu, Anyang, Kyungki-Do 431-070, Korea
XX
DR   MD5; 3fbb7f3e4d2e43f4517d57508425e9cf.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:77539950, gi:77539951, gi:77539952, gi:77539953, gi:77539949.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1068
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1068
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*010201"
FT   mRNA            join(<1..82,183..431,532..813,914..>1068)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*010201"
FT                   /product="MHC class II antigen"
FT   CDS             join(1..82,183..431,532..813,914..1068)
FT                   /codon_start=1
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*010201"
FT                   /product="MHC class II antigen"
FT                   /protein_id="ABA86855.1"
FT                   /translation="MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPS
FT                   GQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYN
FT                   STAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSF
FT                   LSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCA
FT                   LGLSVGLMGIVVGTVFIIQGLRSVGASRHQGPL"
FT   exon            1..82
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*010201"
FT                   /number=1
FT   gap             83..182
FT                   /estimated_length=unknown
FT   exon            183..431
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*010201"
FT                   /number=2
FT   gap             432..531
FT                   /estimated_length=unknown
FT   exon            532..813
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*010201"
FT                   /number=3
FT   gap             814..913
FT                   /estimated_length=unknown
FT   exon            914..1068
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*010201"
FT                   /number=4
XX
SQ   Sequence 1068 BP; 165 A; 203 C; 202 G; 198 T; 300 other;
     atgatcctaa acaaagctct gctgctgggg gccctcgctc tgaccaccgt gatgagcccc        60
     tgtggaggtg aagacattgt ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnctgaccac gttgcctctt gtggtgtaaa cttgtaccag ttttacggtc cctctggcca       240
     gtacacccat gaatttgatg gagatgagca gttctacgtg gacctggaga ggaaggagac       300
     tgcctggcgg tggcctgagt tcagcaaatt tggaggtttt gacccgcagg gtgcactgag       360
     aaacatggct gtggcaaaac acaacttgaa catcatgatt aaacgctaca actctaccgc       420
     tgctaccaat gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naggttcctg       540
     aggtcacagt gttttccaag tctcccgtga cactgggtca gcccaacacc ctcatttgtc       600
     ttgtggacaa catctttcct cctgtggtca acatcacctg gctgagcaat gggcagtcag       660
     tcacagaagg tgtttctgag accagcttcc tctccaagag tgatcattcc ttcttcaaga       720
     tcagttacct caccttcctc ccttctgctg atgagattta tgactgcaag gtggagcact       780
     ggggcctgga ccagcctctt ctgaaacact gggnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnagcctga gattccagcc cctatgtcag agctcacaga gactgtggtc       960
     tgtgccctgg ggttgtctgt gggcctcatg ggcattgtgg tgggcactgt cttcatcatc      1020
     caaggcctgc gttcagttgg tgcttccaga caccaagggc cattgtga                   1068
//