spacer

EBI Dbfetch

ID   DQ162803; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   DQ162803;
XX
DT   07-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*07new allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Li J., Liu X., Li X.;
RT   "Identification of a new HLA-B*07 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Li J., Liu X., Li X.;
RT   ;
RL   Submitted (11-AUG-2005) to the INSDC.
RL   HLA Typing Lab, Liaoning Blood Center, 13 Beihai Street, Dadong District,
RL   Shenyang, Liaoning 110044, China
XX
DR   MD5; 7a750c3e82a9803f545b0c4e6148b465.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q3S604"
FT                   /db_xref="IMGT/HLA:B*07:05:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3S604"
FT                   /protein_id="AAZ95590.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=3
XX
SQ   Sequence 791 BP; 113 A; 172 C; 192 G; 69 T; 245 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agagcatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaagat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc ggagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggacaagct       780
     ggagcgcgct g                                                            791
//


spacer
spacer