spacer

EBI Dbfetch

ID   AH015159; SV 2; linear; genomic DNA; STD; HUM; 1542 BP.
XX
AC   AH015159; DQ145282-DQ145283;
XX
DT   01-JUL-2011 (Rel. 109, Created)
DT   01-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*23 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1542
RA   Ball E.J., Thomas D.M., Kawczak P.R., Smerglia A.R., Cook D.J.;
RT   "HLA-A23 null or variant expression allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1542
RA   Ball E.J., Thomas D.M., Kawczak P.R., Smerglia A.R., Cook D.J.;
RT   ;
RL   Submitted (26-JUL-2005) to the INSDC.
RL   Allogen Laboratories, Cleveland Clinic Foundation, 9500 Euclid Avenue,
RL   Cleveland, OH 44195, USA
XX
DR   MD5; 1a6552b8cfeb5205a1e38c4b403dbf08.
XX
CC   On or before Jun 30, 2011 this sequence version replaced
CC   gi:73354291, gi:73354292, gi:73354290.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1542
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1542
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23"
FT   mRNA            join(<51..320,562..837,1201..>1476)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23"
FT                   /product="MHC class I antigen"
FT   CDS             join(<51..320,562..837,1201..>1476)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23"
FT                   /product="MHC class I antigen"
FT                   /note="null or expression variant allele"
FT                   /db_xref="GOA:Q3YBM1"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YBM1"
FT                   /protein_id="AAZ75663.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VDGLRRYLENGKETLQRTNPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             913..1012
FT                   /estimated_length=unknown
XX
SQ   Sequence 1542 BP; 271 A; 446 C; 486 G; 239 T; 100 other;
     gccgcgccgg gaggagggtc gggcgggtct cagccactcc tcgtccccag gctcccactc        60
     catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc gcttcatcgc       120
     cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg cgagccagag       180
     gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg acgaggagac       240
     agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg cgctccgcta       300
     ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca cgacccctca       360
     tcccccacgg acgggccggg tcgcccacag tctccgggtc cgagatccac cccgaagccg       420
     cgggaccccg agacccttgc cccgggagag gcccaggcgc cttaacccgg tttcattttc       480
     agtttaggcc aaaaatcccc ccgggttggt cggggccggg cggggctcgg gggactgggc       540
     tgaccgcggg gtcggggcca ggttctcaca ccctccagat gatgtttggc tgcgacgtgg       600
     ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc aaggattaca       660
     tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct cagatcaccc       720
     agcgcaagtg ggaggcggcc cgtgtggcgg agcagttgag agcctacctg gagggcacgt       780
     gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag cgcacgagta       840
     ccaggggcca cggggcgcct acctgatcgc ctgtaggtct cccgggctgg cctcccacaa       900
     ggaggggaga cannnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngaagtcgc      1020
     tgttccctcc tcagggaata gaagattatc ccaggtgcct gtgtccaggc tggtgtctgg      1080
     gttctgtgct ctcttcccca tcccgggtgt cctgtccatt ctcaagatgg ccacatgcat      1140
     gctggtggag tgtcccatga cagatgcaaa atgcctgaat tttctgactc ttcccgtcag      1200
     acccccccaa gacacatatg acccaccacc ccatctctga ccatgaggcc actctgagat      1260
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggggagg      1320
     accagaccca ggacacggag cttgtggaga ccaggcctgc aggggatgga accttccaga      1380
     agtgggcagc tgtggtggta ccttctggag aggagcagag atacacctgc catgtgcagc      1440
     atgagggtct gcccaagccc ctcaccctga gatggggtaa ggagggagat gggggtgtca      1500
     tgtctcttag ggaaagcagg agcctctctg gagaccttta gc                         1542
//


spacer
spacer