spacer

EBI Dbfetch

ID   DQ140279; SV 1; linear; mRNA; STD; HUM; 872 BP.
XX
AC   DQ140279;
XX
DT   01-AUG-2006 (Rel. 88, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*090102 variant
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-872
RA   Song C.-H., Lee J.-K., Koh I., Lee J.-Y., Lim Y.-H., Kang J., Cha Y.-Y.,
RA   Yun H.-S., Lee E.-J., Kwack K.;
RT   "Identification of HLA-DRB1*090102 allele in Korean population";
RL   Unpublished.
XX
RN   [2]
RP   1-872
RA   Song C.-H., Lee J.-K., Koh I., Lee J.-Y., Lim Y.-H., Kang J., Cha Y.-Y.,
RA   Yun H.-S., Lee E.-J., Kwack K.;
RT   ;
RL   Submitted (21-JUL-2005) to the INSDC.
RL   Pochon CHA University, CHA Research Institution, 222, Yatap-dong,
RL   Bundang-gu, Seongnam-si, Gyeonggi-do 463 - 070, South Korea
XX
DR   MD5; cd846399d4376460b1269f754f6181e7.
DR   H-InvDB; HIT000391741_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..872
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3-p21.1"
FT                   /mol_type="mRNA"
FT                   /country="South Korea"
FT                   /db_xref="taxon:9606"
FT   gene            1..872
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*090102 variant"
FT   CDS             61..861
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*090102 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q0R326"
FT                   /db_xref="H-InvDB:HIT000391741_02.4"
FT                   /db_xref="IMGT/HLA:DRB1*09:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q0R326"
FT                   /protein_id="AAZ76539.1"
FT                   /translation="MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTQPRFLKQDKFECH
FT                   FFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPVAESWNSQKDFLERRRAEV
FT                   DTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 872 BP; 181 A; 222 C; 288 G; 181 T; 0 other;
     gcgatcctgc tccggccgcc tggcggccgc gggaattcga ttggaattcc tgttctccgc        60
     atggtgtgtc tgaagctccc tggaggctcc tgcatggcag ctctgacagt gacactgatg       120
     gtgctgagct ccccactggc tttggctggg gacacccaac cacgtttctt gaagcaggat       180
     aagtttgagt gtcatttctt caacgggacg gagcgggtgc ggtatctgca cagaggcatc       240
     tataaccaag aggagaacgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       300
     gagctggggc ggcctgtcgc cgagtcctgg aacagccaga aggacttcct ggagcggagg       360
     cgggccgagg tggacaccgt gtgcagacac aactacgggg ttggtgagag cttcacagtg       420
     cagaggcgag tccatcctga ggtgactgtg tatcctgcca agactcagcc cctgcagcac       480
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       540
     ttccggaacg gccaggaaga gaaggctggg gtggtgtcca caggcctgat ccagaatgga       600
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaagtttac       660
     acctgccaag tggagcaccc aagtgtgatg agccctctca cagtggaatg gagagcacgg       720
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       780
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       840
     ccaacaggat tcctgagctg aagtgcagat gg                                     872
//


spacer
spacer