spacer

EBI Dbfetch

ID   DQ135944; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   DQ135944;
XX
DT   13-AUG-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1305 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2006.00728.x.
RX   PUBMED; 17212710.
RA   Tu B., Mack S.J., Lazaro A., Lancaster A., Thomson G., Cao K., Chen M.,
RA   Ling G., Hartzman R., Ng J., Hurley C.K.;
RT   "HLA-A, -B, -C, -DRB1 allele and haplotype frequencies in an African
RT   American population";
RL   Tissue Antigens 69(1):73-85(2007).
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Tu B., Hurley C.K.;
RT   "Novel HLA-Class II allele";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Lazaro A.M., Tu B., Hurley C.K.;
RT   ;
RL   Submitted (19-JUL-2005) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., Washington, DC 20057,
RL   USA
XX
DR   MD5; 441f548a0ae1eedae83913b24b389495.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1305 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1305 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1305 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q45FZ4"
FT                   /db_xref="IMGT/HLA:DRB1*13:05:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q45FZ4"
FT                   /protein_id="AAZ53370.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1305 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 65 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//


spacer
spacer