spacer

EBI Dbfetch

ID   DQ133167; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   DQ133167;
XX
DT   12-AUG-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate VTIS 89969 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*01new allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Jennings K., Varney M., Tait B.;
RT   "New DRB1*01 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Jennings K., Varney M., Tait B.;
RT   ;
RL   Submitted (13-JUL-2005) to the INSDC.
RL   VTIS (Victorian Transplantation & Immunogenetics Service), ARCBS
RL   (Australian Red Cross Blood Service), PO Box 354, South Melbourne, VIC
RL   3205, Australia
XX
DR   MD5; c9caedef3efd99c0ce2a60dad5a5291b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="VTIS 89969"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q45G75"
FT                   /db_xref="IMGT/HLA:DRB1*01:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q45G75"
FT                   /protein_id="AAZ41843.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 62 C; 99 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer