spacer

EBI Dbfetch

ID   DQ130065; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   DQ130065;
XX
DT   12-AUG-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0404 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Mele L.L., Balza G.G., Arata M.M.;
RT   "DRB1*0404: A new allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Mele L.L., Balza G.G., Arata M.M.;
RT   ;
RL   Submitted (14-JUL-2005) to the INSDC.
RL   Haematology and Transfusion Medicine, ASO 'SS Antonio e Biagio e C.Arrigo',
RL   via Venezia 16, Alessandria, AL 15100, Italy
XX
DR   MD5; 5b147f318eb862b4ef002a6032328ead.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0404"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0404"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0404"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q45KF7"
FT                   /db_xref="IMGT/HLA:DRB1*04:56"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q45KF7"
FT                   /protein_id="AAZ42160.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEQRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0404"
FT                   /number=2
FT   variation       186
FT                   /gene="HLA-DRB1"
FT                   /replace="c"
FT                   /compare=AF142461.1
XX
SQ   Sequence 270 BP; 60 A; 64 C; 98 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer