spacer

EBI Dbfetch

ID   AH015101; SV 2; linear; genomic DNA; STD; HUM; 1021 BP.
XX
AC   AH015101; DQ123855-DQ123857;
XX
DT   20-JUL-2011 (Rel. 109, Created)
DT   20-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2601 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1021
RA   Tu B., Lazaro A.M., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1021
RA   Tu B., Lazaro A.M., Hurley C.K.;
RT   ;
RL   Submitted (12-JUL-2005) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., Washington, DC
RL   20007-2197, USA
XX
DR   MD5; 45460337937692cc23a256fda20b16b3.
DR   Ensembl-Gn; ENSG00000206505; homo_sapiens.
DR   Ensembl-Tr; ENST00000376822; homo_sapiens.
DR   Ensembl-Tr; ENST00000383605; homo_sapiens.
DR   Ensembl-Tr; ENST00000383619; homo_sapiens.
DR   Ensembl-Tr; ENST00000549224; homo_sapiens.
DR   Ensembl-Tr; ENST00000616730; homo_sapiens.
XX
CC   On or before Jul 19, 2011 this sequence version replaced
CC   gi:71493119, gi:71493120, gi:71493121, gi:71493118.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1021
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1021
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT   mRNA            join(<1..270,371..646,747..>1021)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1021)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q45NE2"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q45NE2"
FT                   /protein_id="AAZ32761.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1021
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT                   /number=4
XX
SQ   Sequence 1021 BP; 166 A; 250 C; 286 G; 119 T; 200 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgcgcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagagg atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtacca gcaggacgct tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gagacggccc atgaggcgga gcagtggaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaagacg catatgactc accacgctgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgagc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatgggacct tccagaagtg ggcgtctgtg gtggtgcctt ctggacagga       960
     gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg      1020
     g                                                                      1021
//


spacer
spacer