spacer

EBI Dbfetch

ID   DQ112223; SV 1; linear; genomic DNA; STD; HUM; 871 BP.
XX
AC   DQ112223;
XX
DT   28-JUL-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*1216 allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-871
RA   Tilva D.J., Avergas C.U., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele Cw*1216";
RL   Unpublished.
XX
RN   [2]
RP   1-871
RA   Tilva D.J., Avergas C.U., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (30-JUN-2005) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; fcdbf069876cef17cea8b727895fcd8f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..871
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>871
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1216"
FT                   /note="human leukocyte antigen Cw locus"
FT   mRNA            join(<69..338,585..>860)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1216"
FT                   /product="MHC class I antigen"
FT   CDS             join(<69..338,585..>860)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1216"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex"
FT                   /db_xref="GOA:Q45V04"
FT                   /db_xref="IMGT/HLA:C*12:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q45V04"
FT                   /protein_id="AAZ20629.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            69..338
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1216"
FT                   /number=2
FT   exon            585..860
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1216"
FT                   /number=3
XX
SQ   Sequence 871 BP; 150 A; 290 C; 322 G; 109 T; 0 other;
     gggcgcagga cccggggagc cgcgcaggga ggagggtcgg gcgggtctca gcccctcctc        60
     gcccccaggc tcccactcca tgaggtattt cgacaccgcc gtgtcccggc ccggccgcgg       120
     agagccccgc ttcatctcag tgggctacgt ggacgacacg cagttcgtgc ggttcgacag       180
     cgacgccgcg agtccaagag gggagccgcg ggcgccgtgg gtggagcagg aggggccgga       240
     gtattgggac cgggagacac agaagtacaa gcgccaggca caggctgacc gagtgagcct       300
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       360
     gcaggtcacg acccctcccc atcccccacg gacggcccgg gtcgccccga gtctcccggt       420
     ctgagatcca ccccgaggct gcggaacccg cccagaccct cgaccggaga gagccccagt       480
     cacctttacc cggtttcatt ttcagtttag gccaaaatcc ccgcgggttg gtcggggctg       540
     gggcggggct cgggggacgg ggctgaccac gggggcgggg ccagggtctc acaccctcca       600
     gaggatgtac ggctgcgacc tggggcccga cgggcgcctc ctccgcgggt atgaccagtc       660
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctcct ggaccgctgc       720
     ggacacggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgagg cggagcagtg       780
     gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa       840
     ggagacgctg cagcgcgcgg gtaccagggg c                                      871
//


spacer
spacer