spacer

EBI Dbfetch

ID   AH015062; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH015062; DQ105583-DQ105584;
XX
DT   20-JUL-2011 (Rel. 109, Created)
DT   20-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*0804 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2006.00728.x.
RX   PUBMED; 17212710.
RA   Tu B., Mack S.J., Lazaro A., Lancaster A., Thomson G., Cao K., Chen M.,
RA   Ling G., Hartzman R., Ng J., Hurley C.K.;
RT   "HLA-A, -B, -C, -DRB1 allele and haplotype frequencies in an African
RT   American population";
RL   Tissue Antigens 69(1):73-85(2007).
XX
RN   [2]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   "Novel HLA-class I allele";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   ;
RL   Submitted (27-JUN-2005) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., Washington, DC 20007,
RL   USA
XX
CC   On or before Jul 19, 2011 this sequence version replaced
CC   gi:70906819, gi:70906820, gi:70906818.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0804"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0804"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0804"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q4F7G2"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q4F7G2"
FT                   /protein_id="AAZ15024.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0804"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0804"
FT                   /number=3
XX
SQ   Sequence 646 BP; 109 A; 169 C; 197 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaat       480
     gaggacctgc gctcctggac cgccgcggac aaggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaagaag acgctgcagc gcgcgg                      646
//


spacer
spacer