Dbfetch

ID   DQ089022; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   DQ089022;
XX
DT   06-JUL-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Moonsamy P.V., Bonella P.L., Sali P.J., Bentley L.G., Post J.L.,
RA   Goodwin G., Erlich H.E.;
RT   "The identification of a new DPB1 allele in a type 1 diabetes genetics
RT   consortium family";
RL   Unpublished.
XX
RN   [2]
RP   1-264
RA   Moonsamy P.V., Bonella P.L., Sali P.J., Bentley L.G., Post J.L.,
RA   Goodwin G., Erlich H.E.;
RT   ;
RL   Submitted (08-JUN-2005) to the INSDC.
RL   Human Genetics, Roche Molecular Systems, 1145 Atlantic Avenue, Alameda, CA
RL   94501, USA
XX
DR   MD5; b7b1b083156458083613f4548a378bf3.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>264
FT                   /gene="HLA-DPB1"
FT   mRNA            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*110:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAY98352.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEERAVPDRICRHNYELDEAVTLQRR"
FT   exon            <1..264
FT                   /gene="HLA-DPB1"
FT                   /number=2
XX
SQ   Sequence 264 BP; 62 A; 65 C; 97 G; 40 T; 0 other;
     agaattacgt gtaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgcgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg ctgcggagta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca ggatatgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgag                                              264
//