spacer

EBI Dbfetch

ID   AH015078; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH015078; DQ086792-DQ086793;
XX
DT   20-JUL-2011 (Rel. 109, Created)
DT   20-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*020204 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   ;
RL   Submitted (06-JUN-2005) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 6b3e193bb5b95038af42585ffa9ccab0.
XX
CC   On or before Jul 19, 2011 this sequence version replaced
CC   gi:71148617, gi:71148618, gi:71148616.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00066"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*020204 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*020204 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*020204 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q45YJ2"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q45YJ2"
FT                   /protein_id="AAZ28914.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*020204 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*020204 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 108 A; 169 C; 200 G; 69 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer