spacer

EBI Dbfetch

ID   AH015073; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH015073; DQ086782-DQ086783;
XX
DT   20-JUL-2011 (Rel. 109, Created)
DT   20-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2601 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2006.00728.x.
RX   PUBMED; 17212710.
RA   Tu B., Mack S.J., Lazaro A., Lancaster A., Thomson G., Cao K., Chen M.,
RA   Ling G., Hartzman R., Ng J., Hurley C.K.;
RT   "HLA-A, -B, -C, -DRB1 allele and haplotype frequencies in an African
RT   American population";
RL   Tissue Antigens 69(1):73-85(2007).
XX
RN   [2]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Lazaro A.M., Cao K., Hurley C.K.;
RT   ;
RL   Submitted (06-JUN-2005) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 36c7f07548f0d3b0238d537e6ec05bcc.
XX
CC   On or before Jul 19, 2011 this sequence version replaced
CC   gi:71148597, gi:71148598, gi:71148596.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /isolate="NT00587"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT   mRNA            join(<1..269,370..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..269,370..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q45YJ7"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q45YJ7"
FT                   /protein_id="AAZ28909.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            <1..269
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT                   /number=2
FT   gap             270..369
FT                   /estimated_length=unknown
FT   exon            370..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 111 A; 165 C; 196 G; 74 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaagacn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnng gttctcacac catccagagg atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtacca gcaggacgct tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gagacggccc atgaggcgga gcagtggaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer