spacer

EBI Dbfetch

ID   DQ072942; SV 1; linear; genomic DNA; STD; HUM; 1871 BP.
XX
AC   DQ072942;
XX
DT   27-JUN-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens human leukocyte antigen class I-A (HLA-A) gene, HLA-A*0284
DE   allele, exons 2 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1871
RA   Scott J.K., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele: A*0284";
RL   Unpublished.
XX
RN   [2]
RP   1-1871
RA   Scott J.K., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (24-MAY-2005) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 191f84132ca3d54207ffd8642d9ce7db.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1871
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1871
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0284"
FT   mRNA            join(<84..353,595..870,1471..1746,1846..>1871)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0284"
FT                   /product="human leukocyte antigen class I-A"
FT   CDS             join(<84..353,595..870,1471..1746,1846..>1871)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0284"
FT                   /product="human leukocyte antigen class I-A"
FT                   /db_xref="GOA:Q4JLV8"
FT                   /db_xref="IMGT/HLA:A*02:84"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q4JLV8"
FT                   /protein_id="AAY85375.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTFQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTI
FT                   P"
FT   exon            <84..353
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0284"
FT                   /number=2
FT   exon            595..870
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0284"
FT                   /number=3
FT   exon            1471..1746
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0284"
FT                   /number=4
FT   exon            1846..>1871
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0284"
FT                   /number=5
XX
SQ   Sequence 1871 BP; 360 A; 577 C; 594 G; 340 T; 0 other;
     gggcccgcct ggcgggggcg caggacccgg gaagccgcgc cgggaggagg gtcgggcggg        60
     tctcagccac tcctcgtccc caggctctca ctccatgagg tatttctaca cctccgtgtc       120
     ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       180
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       240
     gcaggagggt ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac       300
     tcaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       360
     accccggccc ggggcgcagg tcacgacctc tcatccccca cggacgggcc aggtcgccca       420
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       480
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccaggtt       540
     ggtcggggcg gggcggggct cgggggaccg ggctgaccgc ggggtccggg ccaggttctc       600
     acaccttcca gaggatgtat ggctgcgacg tggggtcgga ctggcgcttc ctccgcgggt       660
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       720
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg       780
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       840
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat       900
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact       960
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1020
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1080
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1140
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1200
     caatgtgtgt gggggtctga gtccagcact tctgagtcct tcagcctcca ctcaggtcag      1260
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1320
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1380
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1440
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1500
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1560
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1620
     ccaggcctgc aggggatgga accttccaga agtgggcggc tgtggtggtg ccttctggac      1680
     aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc ctcaccctga      1740
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      1800
     acctttagca gggtcagggc ccctcacctt cccctctttt cccagagccg tcttcccagc      1860
     ccaccatccc c                                                           1871
//


spacer
spacer