spacer

EBI Dbfetch

ID   DQ022410; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022410;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Praomys degraaffi interphotoreceptor retinoid binding protein (irbp) gene,
DE   partial cds.
XX
KW   .
XX
OS   Praomys degraaffi
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Praomys.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; 60ca439e2779907ea8a6ff1cad54699f.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Praomys degraaffi"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="FMNH 138046"
FT                   /db_xref="taxon:209863"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y129"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y129"
FT                   /protein_id="AAY88276.1"
FT                   /translation="VDTIYDRPSITTTEIWTLPKVLGERYSVDKDVVVLTSGQTGGVAE
FT                   DIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETGPNDPPAATPEVPKEE
FT                   DARRALVDSVFQVSVLPGNVGYLRFDRFADASVLRTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 174 A; 245 C; 256 G; 159 T; 0 other;
     gtggatacca tctacgatcg gccctccatc accaccacag agatctggac cttgcccaag        60
     gtcctagggg agagatacag tgttgacaag gatgtggtgg tcctcaccag tggacagact       120
     gggggagtcg ctgaggacat cgcctacatc cttaagcaga tgcgccgggc catcgtggtg       180
     ggtgagcgca cggagggtgg tgccctggac ctccagaagc tgagaatagg ccagtccaac       240
     ttcttcctca cagtgcctgt gtccaggtcc ctgggacccc taggtggagg tggccagaca       300
     tgggaaggca gtggagtgct gccctgtgtg gggacacctg cagaacaagc cctagaaaaa       360
     gccctggcca tcctcaccct gcgtcgagcc ctgccagggg ttgtcctccg acttcaggaa       420
     gccctccagg actattacac attagtggac cgagtgccgg gcctgctgca ccacctggcc       480
     agcatggact attcggccgt ggtctctgaa gaggacctgg tgacaaagct caacgctggc       540
     ttgcaggctg tgtccgaaga tcccaggctc ctggtgagag ccactggacc cagagaaacc       600
     tcctcaagac ctgagaccgg acctaatgat cccccagcag ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctggtggat tctgtgtttc aggtgtccgt gctgccaggc       720
     aatgtgggct acctgcgctt tgacagattt gcagacgcct ctgtgctgag gacactgggc       780
     ccttatgtac tgcagcaggt gtgggagccc ttgcaggaca cggagcacct catc             834
//


spacer
spacer