spacer

EBI Dbfetch

ID   DQ022409; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022409;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Myomys yemeni interphotoreceptor retinoid binding protein (irbp) gene,
DE   partial cds.
XX
KW   .
XX
OS   Myomyscus yemeni (Yemen white-footed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Myomyscus.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; 32ffa2606251fa4c3c22a04540105e56.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Myomyscus yemeni"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="MNHN 1994-079; Museum National
FT                   d'Histoire Naturelle, Paris, France"
FT                   /db_xref="taxon:485439"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y130"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y130"
FT                   /protein_id="AAY88275.1"
FT                   /translation="VDTIYDRPSNTTTEIWTLPKVLGERYSADKDVVVLTSGHTGGVAE
FT                   DIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLAGMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETGPNDPPAATPEVPKEE
FT                   DARRALVDSVFQVSVLPGNVGYLRFDRFADASVLRTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 168 A; 240 C; 263 G; 163 T; 0 other;
     gtggatacca tctatgatcg gccctccaac accaccacag agatctggac cttgcccaag        60
     gtcctagggg agagatacag tgctgacaag gatgtggtgg tcctcaccag tggacatact       120
     gggggagtcg ctgaggacat cgcctacatc ctcaagcaga tgcgtcgggc catcgtggtg       180
     ggtgagcgga cggagggtgg tgccctggac ctccagaagc tgagaatagg ccagtccaac       240
     ttcttcctca cagtgcctgt gtccaggtcc ctgggacccc taggtggagg tggccagaca       300
     tgggaaggca gtggagtgct gccctgtgtg gggacacctg cagagcaagc cctagaaaag       360
     gccctggcca tcctcaccct gcgtcgggcc ctgcccgggg ttgtcctccg acttcaggaa       420
     gccctacagg actattacac attagtggat cgagtgccgg gtctgctgca ccacctggcc       480
     ggcatggact attcggccgt ggtctctgaa gaggatctag tgacaaagct caacgctggc       540
     ttgcaggctg tgtcggagga tcccaggctc ctggtgagag ccaccggccc cagagaaaca       600
     tcctcaagac ctgagactgg acctaatgat cccccagcag ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctggtggat tctgtgtttc aggtgtccgt gctgcctggc       720
     aatgtgggct acctgcgctt tgacagattt gcagacgcct ctgtgctgag gacgctgggc       780
     ccttatgtgc tgcagcaggt gtgggagccc ttgcaggaca cggagcacct catc             834
//


spacer
spacer