spacer

EBI Dbfetch

ID   DQ022407; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022407;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Myomys fumatus interphotoreceptor retinoid binding protein (irbp) gene,
DE   partial cds.
XX
KW   .
XX
OS   Mastomys natalensis (African soft-furred rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mastomys.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; dd53e624141fc375f440709a33b696b4.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Mastomys natalensis"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="CM TK_33059; Carnegie Museum,
FT                   Pittsburgh, USA"
FT                   /db_xref="taxon:10112"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y132"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y132"
FT                   /protein_id="AAY88273.1"
FT                   /translation="VDTIYDRPSNTTTEIWTLPKVLGERYSADKDVVVLTSGRTGGVAE
FT                   DIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLAGMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETGLNDPPAATPEVPKEE
FT                   DARRALVDSVFQVSVLPGNVGYLRFDRFADASVLRTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 167 A; 240 C; 265 G; 162 T; 0 other;
     gtggatacca tctatgaccg gccctccaac accaccacag agatctggac cttgcccaag        60
     gtcctagggg agagatacag tgctgacaag gatgtggtgg tcctcaccag tggacgtact       120
     gggggagttg ctgaggacat cgcctacatc ctcaagcaga tgcgccgggc catcgtggtg       180
     ggtgagcgga cggagggtgg tgccctggac ctccagaagc tgagaatagg ccagtccaac       240
     ttcttcctca cagtgcctgt gtccaggtcc ctgggacccc taggtggagg tggccagaca       300
     tgggaaggca gtggagtgct gccctgtgtg gggacacctg cagagcaagc cctagaaaag       360
     gccctggcca tcctcaccct gcgtcgggcc ctgcccgggg ttgtcctccg acttcaggaa       420
     gccctacagg actattacac attagtggac cgagtgccag gtctgctgca ccacctggcc       480
     ggcatggact attcggccgt ggtctctgaa gaggacttgg tgacaaagct caacgctggc       540
     ttgcaggctg tgtcggagga tcccaggctc ctggtgagag ccaccggacc cagagaaacc       600
     tcctcaagac ctgagactgg acttaatgat cccccagcag ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctggtggat tctgtgtttc aggtgtccgt gttgccgggc       720
     aatgtgggct acctgcgctt tgacagattt gcagacgcct ctgtgctgag gacgctgggc       780
     ccttatgtgc tgcagcaggt gtgggagccc ttgcaggaca cggagcacct catc             834
//


spacer
spacer