spacer

EBI Dbfetch

ID   DQ022404; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022404;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Myomys albipes interphotoreceptor retinoid binding protein (irbp) gene,
DE   partial cds.
XX
KW   .
XX
OS   Stenocephalemys albipes (White-footed Stenocephalemys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Stenocephalemys.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; 775b4fc2b266d4a054624400cdbacd71.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Stenocephalemys albipes"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="MNHN 1999-561; Museum National
FT                   d'Histoire Naturelle, Paris, France"
FT                   /db_xref="taxon:485440"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y135"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y135"
FT                   /protein_id="AAY88270.1"
FT                   /translation="VDTNYDRPSNTTTEIWTLPKVLGERYSADKDVVVLTSGHTGGVAE
FT                   DIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETELNDPPEATPEVPKEE
FT                   DARRALVDSVFQVSVLPGNVGYLRFDRFADASVLKTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 175 A; 235 C; 260 G; 164 T; 0 other;
     gtggatacca actatgatcg gccctccaac accaccacag agatctggac cttgcccaag        60
     gtcctagggg agaggtacag tgctgacaag gatgtggtgg tcctcaccag tggacatact       120
     ggaggagtcg ctgaggacat tgcctacatc ctcaagcaga tgcgccgggc catcgtggtg       180
     ggtgagagga cagagggtgg tgccctggac ctccagaagc tgagaatagg ccagtccaac       240
     ttcttcctca cagtgcctgt gtccaggtcc ctgggacctc taggtggagg tggccagaca       300
     tgggaaggca gtggagtgct gccctgtgtg gggacacctg cagagcaagc cctagaaaag       360
     gccctggcca tcctcaccct gcgtcgggcc ctgcccgggg ttgtcctccg acttcaggaa       420
     gccctacagg actattacac attagtggac cgagtgccag gtctgctgca ccacctggcc       480
     agcatggact attcggctgt ggtctctgaa gaggacctgg tgacaaagct caatgctggc       540
     ttgcaggctg tgtcggagga tcccaggctc ctggtgagag ccaccggacc cagagaaacc       600
     tcctcaagac ctgagactga acttaatgat cccccagaag ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctggtggat tctgtgtttc aggtgtccgt gctgccgggc       720
     aatgtgggct acctgcgctt tgacagattt gcagatgcct ctgtgctgaa gacgctgggc       780
     ccttatgtgc tgcagcaggt gtgggagccc ttgcaggaca cggagcacct catc             834
//


spacer
spacer