spacer

EBI Dbfetch

ID   DQ022403; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022403;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Mastomys pernanus interphotoreceptor retinoid binding protein (irbp) gene,
DE   partial cds.
XX
KW   .
XX
OS   Mastomys pernanus
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mastomys.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; 76f4b3a08007f651b9e38a9e0cf54925.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Mastomys pernanus"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="RUCA 1624; Department of Biology of the
FT                   University of Antwerp, Belgium"
FT                   /db_xref="taxon:209857"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y136"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y136"
FT                   /protein_id="AAY88269.1"
FT                   /translation="VDTIYDRPSNTTTEIWTLPKVLGERYSAEKDVVVLTSGHTGGVAE
FT                   DIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETGPNDPPAATPEVPKEE
FT                   DARRALVDSVFQVSVLPGNVGYLRFDRFADASVLRTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 173 A; 243 C; 260 G; 158 T; 0 other;
     gtggatacca tctatgatcg accctccaac accaccacag agatctggac cttgcccaag        60
     gtcctagggg agagatacag tgctgagaag gatgtggtgg tcctcaccag tggacatact       120
     gggggagtcg ctgaggacat cgcctacatc ctcaagcaga tgcgccgggc catcgtggtg       180
     ggtgagcgga cggagggtgg tgccctggac ctccagaagc tgagaatagg ccagtccaac       240
     ttcttcctca cagtgcctgt gtccaggtcc ctgggacccc taggtggagg tggccagaca       300
     tgggaaggca gtggagtgct gccctgtgtg gggacacctg cagagcaagc cctagaaaag       360
     gccctggcca tcctcaccct gcgtcgggct ctgccagggg ttgtcctccg acttcaggaa       420
     gccctacaag actattacac attagtggac cgagtgccag gcctgctgca ccacctggcc       480
     agcatggact attcggccgt ggtctctgaa gaggacctgg tgacaaagct caacgctggc       540
     ttgcaggctg tgtccgaaga tcccaggctc ctggtgagag ccaccggacc cagagaaacc       600
     tcctcaagac ctgagactgg acctaatgat cccccagcag ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctggtggat tctgtgtttc aggtgtccgt gctgccgggc       720
     aatgtgggct acctgcgctt tgacagattt gcagacgcct ctgtgctgag gaccctgggc       780
     ccgtatgtgc tgcagcaggt gtgggagccc ttgcaggaca cggagcacct catc             834
//


spacer
spacer