spacer

EBI Dbfetch

ID   DQ022402; SV 1; linear; genomic DNA; STD; ROD; 816 BP.
XX
AC   DQ022402;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Mastomys verheyeni interphotoreceptor retinoid binding protein (irbp) gene,
DE   partial cds.
XX
KW   .
XX
OS   Mastomys verheyeni
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mastomys.
XX
RN   [1]
RP   1-816
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-816
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; 8a47a68d856da281487af209de83b030.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..816
FT                   /organism="Mastomys verheyeni"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="MNHN 2000-039; Museum National
FT                   d'Histoire Naturelle, Paris, France"
FT                   /db_xref="taxon:209858"
FT   gene            <1..>816
FT                   /gene="irbp"
FT   mRNA            <1..>816
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>816
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y137"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y137"
FT                   /protein_id="AAY88268.1"
FT                   /translation="RPSNTTTEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYIL
FT                   KQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCV
FT                   GTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVS
FT                   EEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETGPNDPPAATPEVPKEEDARRAL
FT                   VDSVFQVSVLPGNVGYLRFDRFADASVLRTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 816 BP; 167 A; 237 C; 257 G; 155 T; 0 other;
     cggccctcca ataccaccac agagatctgg actttgccca aggtcctagg ggagagatac        60
     agtgctgaca aggatgtggt ggtcctcacc agtggacata ctgggggagt cgctgaggac       120
     atcgcctaca tcctcaagca gatgcgccgg gccatcgtgg tgggtgagag gacggagggt       180
     ggtgccctgg acctccagaa gctgagaata ggccagtcca acttcttcct cacagtgcct       240
     gtgtccaggt ccctgggacc tctaggtgga ggtggccaga catgggaagg cagtggagtg       300
     ctgccctgtg tggggacacc tgcagagcaa gccctagaaa aggccctggc catcctcacc       360
     ctgcgtcggg ccctgccagg ggttgtcctc cgacttcagg aagccctaca ggactattac       420
     acattagtgg accgagtgcc gggcctgctg caccacctgg ccagcatgga ctattcggcc       480
     gtggtctctg aagaggacct ggtgacaaag ctcaacgctg gcttgcaggc tgtgtccgaa       540
     gatcccaggc tcctggtgag agccaccgga cccagagaaa cctcctcaag acctgagact       600
     ggacctaatg atcccccagc agccacccct gaggtgccca aggaagaaga tgcccggagg       660
     gccctggtgg attctgtgtt tcaggtgtcc gtgctaccgg gcaatgtggg ctacctgcgc       720
     tttgacagat ttgcagacgc ctctgtgctg aggacgctgg gcccttatgt gctgcagcag       780
     gtgtgggagc ccttgcagga cacggagcac ctcatc                                 816
//


spacer
spacer