spacer

EBI Dbfetch

ID   DQ022396; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022396;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Zelotomys hildegardeae interphotoreceptor retinoid binding protein (irbp)
DE   gene, partial cds.
XX
KW   .
XX
OS   Zelotomys hildegardeae
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Zelotomys.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; f6da0aba537b5815f5e13a427fd0f322.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Zelotomys hildegardeae"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="A. Hoffman 3191"
FT                   /db_xref="taxon:209873"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y143"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y143"
FT                   /protein_id="AAY88262.1"
FT                   /translation="VDTIYDRPSDTTTEIWTLPQVLGERYSADKDVVVLTSGHTGGVAE
FT                   DIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETVPNDPPAATPEVPKEE
FT                   DARRALVDSVFQVSVLPGNVGYLRFDRFADASVLRTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 169 A; 241 C; 260 G; 163 T; 1 other;
     gtggatacca tctatgatcg gccctccgac accaccacag agatctggac tttgcctcag        60
     gtcctaggyg agagatacag tgctgacaag gatgtggtgg tcctcaccag tggacatact       120
     gggggagtcg ctgaggacat cgcctacatc ctcaagcaga tgcgccgggc catcgtggtg       180
     ggtgagcgga cggagggtgg tgccctggac ctccagaagc tgagaatagg ccagtccaac       240
     ttcttcctca cagtgcctgt gtccaggtcc ctgggacctc taggtggagg tggccagaca       300
     tgggaaggta gtggagtgct gccctgtgtg gggacacctg cagagcaagc cctagaaaag       360
     gccctggcca tccttaccct gcgtcgggcc ctgccagggg ttgtcctccg acttcaggaa       420
     gccctacagg actattacac attagtggac cgagtgccgg gcctgctgca ccacctggcc       480
     agcatggact attcggccgt ggtctctgaa gaggacctgg tgacaaagct caacgctggc       540
     ttgcaggctg tatccgaaga tcccaggctc ctggtgagag ccaccggacc cagagaaacc       600
     tcctcaagac ccgagactgt acctaatgat cccccagcag ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctggtggat tctgtgtttc aggtgtccgt gctgccgggc       720
     aatgtgggct acctgcgctt tgacagattt gcagacgcct ctgtgctgag gacgctgggc       780
     ccttatgtgc tgcagcaggt gtgggagccc ttgcaggaca cggagcacct catc             834
//


spacer
spacer