spacer

EBI Dbfetch

ID   DQ022395; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022395;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Colomys goslingi interphotoreceptor retinoid binding protein (irbp) gene,
DE   partial cds.
XX
KW   .
XX
OS   Colomys goslingi (African water rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Colomys.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; b90ccb191710c9f682b0540416d41930.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Colomys goslingi"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="SMNS 30124; Staatliches Museum fuer
FT                   Naturkunde, Stuttgart, Germany"
FT                   /db_xref="taxon:119564"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y144"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y144"
FT                   /protein_id="AAY88261.1"
FT                   /translation="VDTIYDRPSNTTTEIWTLPKVLGERYSADKDVVVLTSGHTGGVAE
FT                   DIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLXXXXXXXXXXXXXXXQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPSLLHHLASMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETVPNDPPAATPEVPKEE
FT                   DARRALVDSVFQVSVLPGNVGYLRFDRFADASVLRTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 164 A; 229 C; 241 G; 155 T; 45 other;
     gtggatacca tctatgatcg gccctccaac accaccacag agatctggac tttgcccaag        60
     gtcctaggcg agagatacag tgctgacaag gatgtggtgg tcctcaccag tggacatact       120
     gggggagtcg ctgaggacat cgcctacatc ctcaagcaga tgcgccgggc catcgtggtg       180
     ggtgagcgga cggagggtgg tgccctggac ctccagaagc tgagaatagg ccagtccaac       240
     ttcttcctnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnccagaca       300
     tgggaaggta gtggagtgct gccctgtgtg gggacacctg cagagcaagc cctagaaaag       360
     gccctggcca tccttaccct gcgtcgggcc ctgccagggg ttgtcctccg acttcaggaa       420
     gccctccagg actattacac attagtggac cgagtgccga gcctgctgca ccacctggcc       480
     agcatggact attcggccgt ggtctctgaa gaggacctgg tgacaaagct caacgctggc       540
     ttgcaggctg tgtccgaaga tcccaggctc ctggtgagag ccactggacc cagagaaacc       600
     tcctcaagac ctgagactgt acctaatgat cccccagcag ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctggtggat tctgtgtttc aggtgtccgt tctgccgggc       720
     aatgtgggct acctgcgctt tgacagattt gcagacgcct ctgtgctgag gacgctgggc       780
     ccttatgtgc tgcagcaggt gtgggagccc ttgcaggaca cggagcacct catc             834
//


spacer
spacer