spacer

EBI Dbfetch

ID   DQ022394; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022394;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Malacomys verschureni interphotoreceptor retinoid binding protein (irbp)
DE   gene, partial cds.
XX
KW   .
XX
OS   Praomys verschureni (Verschuren's Praomys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Praomys.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Praomys verschureni"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="SMNS 131; Staatliches Museum fuer
FT                   Naturkunde, Stuttgart, Germany"
FT                   /db_xref="taxon:1141936"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y145"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y145"
FT                   /protein_id="AAY88260.1"
FT                   /translation="VDTIYDRPSDTTTEIWTLPKVLGERYSADKDVVVLTSGHTGGVAE
FT                   DIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSDFFLXXXXXXXXXXXXXXXQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETGPNDPPAATPEVPKEE
FT                   DARRALVDSVFQVSVLPGNVGYLRFDRFADASVLRTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 161 A; 231 C; 246 G; 147 T; 49 other;
     gtggatacca tctacgatcg tccctccgac accaccacag agatctggac cttgcccaag        60
     gtcctagggg agagatacag tgctgacaag gatgtggtgg tcctcaccag tggacatact       120
     gggggagtcg ctgaggacat cgcctacatc ctcaagcaga tgcgccgggc catcgtggtg       180
     ggtgagcgga cggagggtgg tgccctggac ctccagaagc tgagaatagg ncagtccgac       240
     ttcttcctnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnncagaca       300
     tgggaaggca gtggagtgct gccctgtgtg gggacacctg cagagcaagc cctagaaaag       360
     gccctggcca tcctcaccct gcgtcgggcc ctgccagggg ttgtcctccg acttcaggaa       420
     gccctccagg actactacac attagtggac cgagtgccgg gcctgctgca ccacctggcc       480
     agcatggact attcggccgt ggtctctgaa gaggacctgg tgacaaagct caacgctggc       540
     ttgcaggctg tgtccgaaga tcccaggctc ctggtgagag ccaccggacc cagagaaacc       600
     tcctcaagac ctgagactgg acctaatgat cccccagcag ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctggtggay tctgtgtttc aggtgtccgt gctgccgggc       720
     aatgtgggct acctgcgctt tgacagattt gcagaygcct ctgtgctgag gacgctgggc       780
     ccttatgtgc tgcagcaggt gtgggagccc ttgcaggaca cggagcacct catc             834
//


spacer
spacer