spacer

EBI Dbfetch

ID   DQ022389; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022389;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Grammomys sp. MNHN 1999-293 interphotoreceptor retinoid binding protein
DE   (irbp) gene, partial cds.
XX
KW   .
XX
OS   Grammomys sp. MNHN 1999-293
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Grammomys.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; 16576bda130d21707f7b1ad36c016ddb.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Grammomys sp. MNHN 1999-293"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="MNHN 1999-293; Museum National
FT                   d'Histoire Naturelle, Paris, France"
FT                   /db_xref="taxon:333392"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y150"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y150"
FT                   /protein_id="AAY88255.1"
FT                   /translation="VDTIYDRPSNTTTEIWTLPKVLGERYSADKDVVILTSGHTGGVAE
FT                   DIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRVTGPRETSSRPETGPNDPPAATPEVPKEE
FT                   DARRALVESVFQVSVLPGNVGYLRFDRFADASVLKTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 181 A; 235 C; 252 G; 166 T; 0 other;
     gtagatacca tctatgatcg tccctccaac accaccacag agatctggac cttgcccaag        60
     gtcctaggag agagatacag tgctgacaag gatgtggtga tccttaccag tggacatact       120
     gggggagtgg ctgaggacat cgcctacatc ctcaagcaga tgcgcagggc catcgtggtg       180
     ggtgagcgga ctgagggtgg tgccctggac ctccagaagc taagaatagg tcagtccaac       240
     ttcttcctca cagtgcctgt gtccaggtcc ctgggaccct taggtggagg tggccagact       300
     tgggaaggca gtggagtgct gccctgtgtg gggacacctg cagagcaagc cctagaaaag       360
     gccctggcca tcctcaccct gcgtcgtgcc ctgccaggag ttgttctccg acttcaggaa       420
     gccctacagg actattacac attagtggac cgagtgccgg gcctgctgca ccacctggct       480
     agcatggact actcagccgt ggtctctgaa gaggacttgg tgacaaagct caatgctggc       540
     ttgcaggcag tgtcggagga tcccagactc ctggtgagag tcactgggcc cagagaaacc       600
     tcctcaagac ctgagactgg gcctaatgac cccccagcag ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctagtggag tctgtgtttc aagtgtcggt gctgccaggc       720
     aatgtgggct acctgcgctt cgacagattt gcagacgcct ctgtgctgaa gacactgggc       780
     ccttatgtgc tgcagcaagt gtgggagccc cttcaggaca cggagcacct catc             834
//


spacer
spacer