spacer

EBI Dbfetch

ID   DQ022388; SV 1; linear; genomic DNA; STD; ROD; 834 BP.
XX
AC   DQ022388;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Hybomys univittatus interphotoreceptor retinoid binding protein (irbp)
DE   gene, partial cds.
XX
KW   .
XX
OS   Hybomys univittatus (Peter's striped mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Hybomys.
XX
RN   [1]
RP   1-834
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-834
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; a32e13ce74bbfc29ff44f74a0b8327e3.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..834
FT                   /organism="Hybomys univittatus"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="MNHN 2001-072; Museum National
FT                   d'Histoire Naturelle, Paris, France"
FT                   /db_xref="taxon:71162"
FT   gene            <1..>834
FT                   /gene="irbp"
FT   mRNA            <1..>834
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>834
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q2Y151"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y151"
FT                   /protein_id="AAY88254.1"
FT                   /translation="VDTIYDRPSNTTTEIWTLPKILGERYSADKDVVILTSGHTGGVAE
FT                   DITYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGS
FT                   GVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMD
FT                   YSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPDTGPNEPPATTPEVPKEE
FT                   DARRALVDSVFQVSVLPGNVGYLRFNRFTDASVLKTLGPYVLQQVWEPLQDTEHLI"
XX
SQ   Sequence 834 BP; 186 A; 230 C; 246 G; 172 T; 0 other;
     gtagatacca tctatgatcg cccctccaat accaccacag agatctggac cttgcctaag        60
     atcctaggag agagatacag tgctgacaag gatgtggtga ttcttaccag tggacatact       120
     gggggagtgg ctgaggatat cacctacata ctcaagcaga tgcgcagggc catcgtggtg       180
     ggtgagagga cagagggtgg tgccctggac ctccagaagc tgagaatagg tcagtccaac       240
     ttcttcctca cagtgcctgt gtccaggtcc ctgggacccc taggtggagg tggccagaca       300
     tgggaaggca gtggagtgct cccctgtgtg gggacacctg cagaacaagc cctagaaaag       360
     gccctggcca tcctcaccct ccgtcgtgcc ctgccagggg ttgtcctccg acttcaggaa       420
     gctctacagg actattacac attagtggac cgagtgccgg gcctgctgca tcacctggct       480
     agcatggact actcagccgt tgtctctgaa gaggacttgg tgacaaagtt gaatgctggc       540
     ttgcaggctg tgtcggagga tcccaggctc ctggtgagag ccactgggcc cagagaaaca       600
     tcctcaagac ctgatactgg gcctaatgag cccccagcca ccacccctga ggtgcccaag       660
     gaagaagatg cccggagggc cctagtggac tctgtgtttc aagtgtctgt gctgccaggc       720
     aatgtgggct acctgcgctt caacagattt acagatgcct ctgtgctgaa gacactgggc       780
     ccttatgtgc tgcagcaggt gtgggagccc cttcaggaca cggagcacct catc             834
//


spacer
spacer