spacer

EBI Dbfetch

ID   DQ022381; SV 1; linear; genomic DNA; STD; ROD; 1113 BP.
XX
AC   DQ022381;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Cremnomys cutchicus voucher HM 11.7337 cytochrome b (cytb) gene, partial
DE   cds; mitochondrial.
XX
KW   .
XX
OS   Cremnomys cutchicus (Cutch rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Cremnomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1113
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-1113
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; bfc079d348a79a047c6afe11db61f8d2.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1113
FT                   /organism="Cremnomys cutchicus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="HM 11.7337; Harrison Institute,
FT                   Sevenoaks, United Kingdom"
FT                   /db_xref="taxon:333390"
FT   gene            <1..>1113
FT                   /gene="cytb"
FT   CDS             <1..>1113
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q2Y158"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y158"
FT                   /protein_id="AAZ15872.1"
FT                   /translation="MFKIINHSFIDLPTPSNISSWWNFGSLLGICLMIQILTGLFLAMH
FT                   YTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYYGSYVFTETW
FT                   NIGIILLFSVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDK
FT                   ATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLXSDSDKIPFHPYYTIKDFLG
FT                   VFMMFMSLMILVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGG
FT                   VLALILSILILMFLPLLHTSKLRSMMFRPITQTLYWMLVANLLILTWIGGQPVEHPFII
FT                   IGQLASISYFSIILILMPIAGIIENSMLKLN"
XX
SQ   Sequence 1113 BP; 374 A; 287 C; 127 G; 322 T; 3 other;
     atattcaaaa ttattaatca ctcattcatt gacctcccta ccccatccaa catctcatca        60
     tgatgaaact ttggttcact actaggaatc tgcttaataa tccaaatttt aacaggtcta       120
     ttcctagcca tacactacac atctgacaca ataacagcct tttcatcagt aacacacatc       180
     tgccgagacg taaactatgg ctgattaatc cgatacatac atgcaaacgg agcttcaata       240
     ttttttattt gcttattcct tcatgtagga cgaggtatat actacggatc atatgtcttc       300
     acagaaacat gaaacatcgg aattatccta ctattttcag ttatagccac agcattcata       360
     ggatatgtat taccatgagg acaaatatca ttctgaggag caacagtaat cacaaactta       420
     ctctcagcca tcccatatat tggaaccacc ctagtagaat gaatttgagg aggtttttca       480
     gtagacaaag ccactttaac acgcttcttc gcattccact tcatyctacc attcatcatt       540
     gcagccctag caatcgtcca tctattattc ctacacgaaa ctggctctaa caacccaaca       600
     gggctaawct cagactcaga caaaatccca tttcacccat actatacaat caaagacttc       660
     ttaggagttt tcataatatt tatatcccta atgattctag tactattttt tccagactta       720
     ctaggagatc cagacaacta cacaccagct aacccactca acaccccacc ccacatcaaa       780
     ccagaatgat atttcctatt tgcctacgcn attctacgat ctattcctaa taaattagga       840
     ggagtactag ccctaattct atcaatccta atcctaatat ttttaccatt attacacaca       900
     tcaaaactac gaagcataat attccgtcca atcacacaaa ccttatactg aatactagta       960
     gccaacctcc taatcctaac ctgaatcgga ggacaacccg tagaacaccc atttattatt      1020
     atcggacaac tagcatccat tagctacttc tccattattc taatcctaat accaattgca      1080
     ggaatcatcg aaaacagtat actaaaacta aat                                   1113
//


spacer
spacer