Dbfetch

ID   DQ022379; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   DQ022379;
XX
DT   19-NOV-2005 (Rel. 85, Created)
DT   19-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Malacomys edwardsi voucher R24689 cytochrome b (cytb) gene, partial cds;
DE   mitochondrial.
XX
KW   .
XX
OS   Malacomys edwardsi (Edward's swamp rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Malacomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/j.ympev.2005.06.018.
RX   PUBMED; 16111900.
RA   Lecompte E., Denys C., Granjon L.;
RT   "Confrontation of morphological and molecular data: the Praomys group
RT   (Rodentia, Murinae) as a case of adaptive convergences and morphological
RT   stasis";
RL   Mol. Phylogenet. Evol. 37(3):899-919(2005).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Denys C., Granjon L.;
RT   ;
RL   Submitted (30-APR-2005) to the INSDC.
RL   Departement Systematique et Evolution, Museum National d'Histoire
RL   Naturelle, UMR 5202, Case Postale 51, 55 rue Buffon, Paris 75005, France
XX
DR   MD5; 0f72afc44a0b0e4152fcbe44eb704430.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Malacomys edwardsi"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="R24689"
FT                   /db_xref="taxon:333388"
FT   gene            1..>1140
FT                   /gene="cytb"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q2Y160"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y160"
FT                   /protein_id="AAZ15870.1"
FT                   /translation="MTNMRKSHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMVQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVILMFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIILALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGLFIMIMFLMMLTLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPFLHTSKQRSLTFRPITQILFWILVANLFILTWIGG
FT                   QPVEHPFVIIGQLASISYFSIILILMPISGIIENKMLKLY"
XX
SQ   Sequence 1140 BP; 367 A; 319 C; 128 G; 326 T; 0 other;
     atgacaaaca tacgaaaatc acacccacta ctaaaaatca tcaaccattc cttcattgac        60
     ctccccgctc catccaacat ttcatcatga tgaaatttcg gttcactcct aggaatctgc       120
     cttatagtac aaatcatcac aggcctattt ttagccatac actatacatc agacactaca       180
     acagcatttt catcagttac acatatctgc cgagatgtaa actacggatg actaatccga       240
     tacatacacg caaacggagc ctcaatattc tttatctgcc tcttcctcca tgtcggacga       300
     ggcatatact atggatccta tactttccta gaaacatgaa acatcggagt cattctaata       360
     tttgcagtta tagccactgc attcataggt tatgtacttc catgaggaca aatatcattc       420
     tgaggagcca cagtaattac aaacttactt tcagcaatcc catacattgg gacaacccta       480
     gtagaatgaa tctgaggagg attttcagta gacaaagcca ccctaacacg ctttttcgca       540
     ttccacttta ttctcccatt tattatccta gcccttgtaa ttgttcacct cctatttctc       600
     cacgaaacag gctcaaacaa tccaacaggc ctcaactcag actcagacaa aattccattc       660
     cacccatact acaccattaa agatattcta ggattattca ttataatcat attcctaata       720
     atattaaccc tattcttccc agacctccta ggagatccag acaattacac accagccaac       780
     ccactaaaca ctccaccaca catcaaacca gaatgatact tcctattcgc ttatgccatc       840
     ctacgatcta ttccaaacaa actaggaggt gttttagccc taattctatc aatcttaatt       900
     ctagccctcc taccctttct ccacacctca aaacaacgaa gccttacatt tcgaccaatc       960
     acacaaatcc tattctgaat tctagtagcc aacctcttta tcttaacttg aattggaggc      1020
     caacctgtag aacacccatt tgtcatcatc ggccaactag cctcaatctc atacttctcc      1080
     attattctta tcctcatacc aatctcagga attattgaaa acaaaatatt aaaattgtac      1140
//