spacer

EBI Dbfetch

ID   DQ019080; SV 1; linear; genomic DNA; STD; ROD; 783 BP.
XX
AC   DQ019080;
XX
DT   17-OCT-2005 (Rel. 85, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Zelotomys hildegardeae growth hormone receptor (ghr) gene, exon 10 and
DE   partial cds.
XX
KW   .
XX
OS   Zelotomys hildegardeae
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Zelotomys.
XX
RN   [1]
RP   1-783
RX   DOI; 10.1016/j.ympev.2005.04.016.
RX   PUBMED; 15975830.
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   "Multigene phylogeny of the Old World mice, Murinae, reveals distinct
RT   geographic lineages and the declining utility of mitochondrial genes
RT   compared to nuclear genes";
RL   Mol. Phylogenet. Evol. 37(2):370-388(2005).
XX
RN   [2]
RP   1-783
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   ;
RL   Submitted (26-APR-2005) to the INSDC.
RL   Pediatrics, University of Tennessee Health Science Center, 50 North Dunlap,
RL   308 West Patient Tower, Memphis, TN 38103, USA
XX
DR   MD5; 637b90d0724d4dea8cc3e6893f06ab71.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..783
FT                   /organism="Zelotomys hildegardeae"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:209873"
FT   gene            <1..>783
FT                   /gene="ghr"
FT   mRNA            <1..>783
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>783
FT                   /codon_start=3
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q38S67"
FT                   /protein_id="AAY83875.1"
FT                   /translation="ELDIDDADVDEKTEGSDTDRLLSDDHEKSAGILGAKDDDSGRTSC
FT                   YDPDILDTDFHTSDVCEGTSEFAQPQKLKPEADLLCLDQKNLKNSPYEASLGSLHPSIT
FT                   LTVEDKPQPLLGSETESTHQLASTPMSNPTSLANIDFYAQVSDITPAGGVVLSPGQKIK
FT                   AGIAQGNTQXEVATPCQENYSMNSAYFCESDAKKCIAVAPRMEATSCVKPSFNQEDIYI
FT                   TTESLTTTARMSETAHIAPDAEMPVPDYTTVHTVQSPR"
FT   exon            <1..>783
FT                   /gene="ghr"
FT                   /number=10
XX
SQ   Sequence 783 BP; 217 A; 214 C; 186 G; 165 T; 1 other;
     ttgagctaga tatagatgat gctgatgtgg atgagaagac tgaagggtcc gacacagaca        60
     ggcttctaag cgatgaccat gagaaatcag ccggtatcct tggagcaaag gatgatgatt       120
     ctggacgtac cagctgttat gaccctgaca ttttggatac tgatttccac accagtgacg       180
     tatgtgaggg tacctcggag tttgctcagc cacagaagtt gaaaccggaa gctgatctct       240
     tgtgccttga ccagaagaat ctgaagaact cgccttatga ggcttccctt ggctctctgc       300
     acccctccat taccctgaca gtggaagaca agccacagcc acttctgggc agtgaaactg       360
     agtcaaccca ccaactcgcc tctacaccga tgagcaatcc cacgtcactg gcaaacattg       420
     acttttatgc ccaagtaagt gacattacac cagcaggtgg tgtagtcctt tccccaggcc       480
     aaaagattaa ggcagggata gcccagggca acacccagyc ggaggtggcc acaccctgcc       540
     aagaaaatta cagcatgaac agtgcctact tctgtgagtc agatgccaaa aagtgcatcg       600
     ctgtggcccc acgcatggag gccacgtcat gtgtaaaacc aagctttaac caagaggaca       660
     tttacatcac caccgaaagc cttaccacta ctgcccggat gtccgagaca gcacatattg       720
     ctccagatgc tgagatgcct gtcccagact acaccacggt tcacaccgtg cagtctccaa       780
     ggg                                                                     783
//


spacer
spacer