spacer

EBI Dbfetch

ID   DQ019076; SV 1; linear; genomic DNA; STD; ROD; 832 BP.
XX
AC   DQ019076;
XX
DT   17-OCT-2005 (Rel. 85, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Stochomys longicaudatus growth hormone receptor (ghr) gene, exon 10 and
DE   partial cds.
XX
KW   .
XX
OS   Stochomys longicaudatus (target rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Stochomys.
XX
RN   [1]
RP   1-832
RX   DOI; 10.1016/j.ympev.2005.04.016.
RX   PUBMED; 15975830.
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   "Multigene phylogeny of the Old World mice, Murinae, reveals distinct
RT   geographic lineages and the declining utility of mitochondrial genes
RT   compared to nuclear genes";
RL   Mol. Phylogenet. Evol. 37(2):370-388(2005).
XX
RN   [2]
RP   1-832
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   ;
RL   Submitted (26-APR-2005) to the INSDC.
RL   Pediatrics, University of Tennessee Health Science Center, 50 North Dunlap,
RL   308 West Patient Tower, Memphis, TN 38103, USA
XX
DR   MD5; 5c41a39cfe9250c7bb0e8f9fd6280993.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..832
FT                   /organism="Stochomys longicaudatus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:34856"
FT   gene            <1..>832
FT                   /gene="ghr"
FT   mRNA            <1..>832
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>832
FT                   /codon_start=3
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q38S71"
FT                   /protein_id="AAY83871.1"
FT                   /translation="FIELDIDDVDEKTEGSDTDRLLSGDHEKSAGILGAKDDDSGRTSC
FT                   YDPDIVDTDFHTSGMCDGTSEFAQPQKLNEEADLLCLDQKNLKNSPYDASLGSLHPSIT
FT                   LTEEDQTRPLLGSETESTHQLTSTPMSNPVSLTNIDFYAQVSDITSAGGVVLSPGQKIK
FT                   AGIAQGNTQPEVATPCQENYSMNSAYFCESDAKKCITVAPCMEATSCVKPSFNQEDIYI
FT                   TTESLTTTPRMSETADTAPDAEMPVPDYTTVHTVQSPRGLILNATALPLPDKKK"
FT   exon            <1..>832
FT                   /gene="ghr"
FT                   /number=10
XX
SQ   Sequence 832 BP; 235 A; 224 C; 191 G; 182 T; 0 other;
     agttcattga gctagatatt gatgacgtgg atgagaagac tgaagggtca gacacagaca        60
     gacttctaag cggtgaccat gagaaatcag ctggtatcct tggagcaaag gatgacgatt       120
     ctggacgtac cagctgttat gaccctgaca ttgtggatac tgatttccac accagtggca       180
     tgtgtgatgg tacctcggag tttgctcagc cacagaagtt aaatgaggaa gctgatctct       240
     tgtgccttga ccagaagaat ctgaagaact cgccttatga tgcttccctt ggctccctgc       300
     acccctccat taccctgaca gaggaagatc agacacggcc acttctaggc agtgaaactg       360
     agtcaaccca ccaactcacc tctacaccaa tgagcaatcc cgtatcactg acaaacattg       420
     acttttatgc ccaagtaagc gacattacat cagcaggtgg tgtagtcctt tccccaggcc       480
     aaaagattaa ggcagggata gcccagggca acacccagcc ggaggtggcc acgccctgcc       540
     aagagaatta cagcatgaac agtgcctact tctgtgagtc agatgccaaa aagtgcatca       600
     ctgtggcccc ttgcatggag gccacgtcat gtgtaaaacc aagctttaac caagaggaca       660
     tttacatcac cacagaaagc cttaccacta ctccccggat gtccgagaca gcagatactg       720
     ctccagatgc tgagatgcct gtcccagact acaccacggt tcacaccgtg caatctccaa       780
     ggggccttat actcaacgcg actgctttgc ctttgcctga caaaaagaag tt               832
//


spacer
spacer