spacer

EBI Dbfetch

ID   DQ019075; SV 1; linear; genomic DNA; STD; ROD; 844 BP.
XX
AC   DQ019075;
XX
DT   17-OCT-2005 (Rel. 85, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Rhynchomys isarogensis growth hormone receptor (ghr) gene, exon 10 and
DE   partial cds.
XX
KW   .
XX
OS   Rhynchomys isarogensis (Isarog shrew-rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rhynchomys.
XX
RN   [1]
RP   1-844
RX   DOI; 10.1016/j.ympev.2005.04.016.
RX   PUBMED; 15975830.
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   "Multigene phylogeny of the Old World mice, Murinae, reveals distinct
RT   geographic lineages and the declining utility of mitochondrial genes
RT   compared to nuclear genes";
RL   Mol. Phylogenet. Evol. 37(2):370-388(2005).
XX
RN   [2]
RP   1-844
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   ;
RL   Submitted (26-APR-2005) to the INSDC.
RL   Pediatrics, University of Tennessee Health Science Center, 50 North Dunlap,
RL   308 West Patient Tower, Memphis, TN 38103, USA
XX
DR   MD5; 19e1bf0be2a0dbaac35e2f14214983ac.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..844
FT                   /organism="Rhynchomys isarogensis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:238000"
FT   gene            <1..>844
FT                   /gene="ghr"
FT   mRNA            <1..>844
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>844
FT                   /codon_start=3
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q38S72"
FT                   /protein_id="AAY83870.1"
FT                   /translation="ELDIDDTDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYD
FT                   PDILDTDFHTSDMCNGTSEFAQPEMLKSEADLLCLDQKNLKNLPYDASLGSLHPSITLT
FT                   VEDKPQPLLGSETESTHQLASTRMSNPASLANIDFYAQVSDITPAGGVVLSPGQKIKAG
FT                   ITQGNTQLEVATPCQENYSMNSAYFCESDAKKCISVAPRVEVTSCVKPSFNQEDVYITT
FT                   ESLTTTARMSKTADTAPDAEMPVPDYTTVHTVQSPRGLILNATALPLPDKKKFLSSCG"
FT   exon            <1..>844
FT                   /gene="ghr"
FT                   /number=10
XX
SQ   Sequence 844 BP; 237 A; 224 C; 190 G; 193 T; 0 other;
     ttgagctaga tattgatgac acggatgaga agactgaagg gtcagacaca gacagacttc        60
     taagcaatga ccatgagaaa tcagctggta tccttggagc aaaggatgat gattctggac       120
     ggaccagctg ttatgaccct gacattttgg atactgattt ccacaccagt gacatgtgta       180
     atggtacctc ggaatttgct cagccagaga tgttaaaatc agaagctgat ctcttgtgcc       240
     ttgaccagaa gaatctgaag aacttgcctt atgatgcttc ccttggctct ctgcacccct       300
     ccattaccct gacagtggaa gacaaaccac agccacttct gggcagtgaa actgagtcaa       360
     cccaccaact cgcctctaca cggatgagca atcctgcatc actggcaaac attgactttt       420
     atgcccaagt aagtgacatt acaccagcag gtggtgtagt cctttcccca ggccaaaaga       480
     ttaaggcagg gataacccag ggcaacaccc agctggaggt ggccacgccc tgccaagaaa       540
     attacagcat gaacagtgcc tacttctgtg agtcagatgc caaaaagtgc atctctgtgg       600
     cccctcgcgt ggaggtcacg tcatgtgtaa aaccaagctt taaccaagag gacgtttaca       660
     tcaccacaga aagccttacc actactgccc gtatgtccaa gacagcagat actgctccag       720
     atgctgagat gcctgtccca gactacacca cggttcacac agtgcagtct ccaaggggcc       780
     ttatactcaa cgcgactgct ttgcctttgc ctgacaaaaa gaagtttctc tcctcgtgtg       840
     gcta                                                                    844
//


spacer
spacer