spacer

EBI Dbfetch

ID   DQ019074; SV 1; linear; genomic DNA; STD; ROD; 822 BP.
XX
AC   DQ019074;
XX
DT   17-OCT-2005 (Rel. 85, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Rattus exulans growth hormone receptor (ghr) gene, exon 10 and partial cds.
XX
KW   .
XX
OS   Rattus exulans (Polynesian rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rattus.
XX
RN   [1]
RP   1-822
RX   DOI; 10.1016/j.ympev.2005.04.016.
RX   PUBMED; 15975830.
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   "Multigene phylogeny of the Old World mice, Murinae, reveals distinct
RT   geographic lineages and the declining utility of mitochondrial genes
RT   compared to nuclear genes";
RL   Mol. Phylogenet. Evol. 37(2):370-388(2005).
XX
RN   [2]
RP   1-822
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   ;
RL   Submitted (26-APR-2005) to the INSDC.
RL   Pediatrics, University of Tennessee Health Science Center, 50 North Dunlap,
RL   308 West Patient Tower, Memphis, TN 38103, USA
XX
DR   MD5; 1c0d6d53ae8ba403b2917039c8bf2a5b.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Rattus exulans"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:34854"
FT   gene            <1..>822
FT                   /gene="ghr"
FT   mRNA            <1..>822
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>822
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q38S73"
FT                   /protein_id="AAY83869.1"
FT                   /translation="IELDIDDADEKTEESDTDRLLSDDQEKSAGILGAKDDDSGRTSCY
FT                   DPDILDTDFHTSDMCDGTSEFAQPQKLKAEADLLCLDQKNLKNSPYDASLGSLHPSVTL
FT                   TMEDKSQPLLDSETESTHQLVSTPMSNPMSLANIDFYAQVSDITPAGGVVLSPGQKIKA
FT                   GLAQGNTQLEVASPCQENYSVNSAYFCESDAKKCIAAAPHMEATTCVKPSFNQEDIYIT
FT                   TESLTTTARMSETADTAPDAEMPVPDYTTVHTVQSPRGLILNATALPLPDK"
FT   exon            <1..>822
FT                   /gene="ghr"
FT                   /number=10
XX
SQ   Sequence 822 BP; 230 A; 226 C; 188 G; 178 T; 0 other;
     cattgagctg gatattgatg atgcggatga gaagactgaa gagtcagaca ccgacagact        60
     tctaagcgat gaccaggaga aatcagctgg tatccttgga gcaaaggatg acgattctgg       120
     acgtaccagc tgttatgacc ctgacatttt ggataccgat ttccacacca gtgacatgtg       180
     cgatggtacc tcggagtttg ctcagccgca gaagttaaaa gcagaagctg atctcttgtg       240
     ccttgaccag aagaatctga agaactcgcc ttatgatgct tcccttggct ctctgcaccc       300
     ttccgttacc ctgacaatgg aagacaaatc acagccactt ctggacagtg aaactgagtc       360
     aacccaccaa ctcgtctcta caccaatgag caatcccatg tcactggcaa acattgactt       420
     ttatgcccaa gtaagcgaca ttacaccagc aggtggtgta gtcctttctc caggccaaaa       480
     gattaaggcg gggttagccc agggcaacac ccagctggag gtggcctcgc cctgccaaga       540
     aaattacagc gtgaacagtg cctacttctg tgagtcagat gccaaaaagt gcatcgctgc       600
     ggcccctcac atggaggcca cgacatgtgt aaaaccaagc tttaaccaag aggacattta       660
     catcaccaca gaaagcctta ccactactgc ccgaatgtcc gagacagcag ataccgctcc       720
     agatgctgag atgcctgtcc cagactacac cacggttcac accgtgcagt ctccaagggg       780
     ccttatactc aacgcgactg ctttgccttt gcctgacaaa aa                          822
//


spacer
spacer