spacer

EBI Dbfetch

ID   DQ019060; SV 1; linear; genomic DNA; STD; ROD; 726 BP.
XX
AC   DQ019060;
XX
DT   17-OCT-2005 (Rel. 85, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Hylomyscus parvus growth hormone receptor (ghr) gene, exon 10 and partial
DE   cds.
XX
KW   .
XX
OS   Hylomyscus parvus
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Hylomyscus.
XX
RN   [1]
RP   1-726
RX   DOI; 10.1016/j.ympev.2005.04.016.
RX   PUBMED; 15975830.
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   "Multigene phylogeny of the Old World mice, Murinae, reveals distinct
RT   geographic lineages and the declining utility of mitochondrial genes
RT   compared to nuclear genes";
RL   Mol. Phylogenet. Evol. 37(2):370-388(2005).
XX
RN   [2]
RP   1-726
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   ;
RL   Submitted (26-APR-2005) to the INSDC.
RL   Pediatrics, University of Tennessee Health Science Center, 50 North Dunlap,
RL   308 West Patient Tower, Memphis, TN 38103, USA
XX
DR   MD5; d24d2e179187938b586bb13cc01f938b.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..726
FT                   /organism="Hylomyscus parvus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:209855"
FT   gene            <1..>726
FT                   /gene="ghr"
FT   mRNA            <1..>726
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>726
FT                   /codon_start=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q38S87"
FT                   /protein_id="AAY83855.1"
FT                   /translation="EEVNTILGIHDNYKPDFYNDDSWVEFIELDIDDADADEKTEGSDT
FT                   DRLLSDDHEKSASILGAKDDDSGRTSCYDPDILDTDFHTSDICDGTSEFAQPQKLKAEA
FT                   DLLCLDQKNLKNSPYETSLDSLHPSITLTVEDKPQPLLGSETESTYQLASTPVSNPTSL
FT                   ANIDFYAQVSDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPCQENYSMNSAYFCESDV
FT                   KKCIAVAPRMDATSCVKPSF"
FT   exon            <1..>726
FT                   /gene="ghr"
FT                   /number=10
XX
SQ   Sequence 726 BP; 213 A; 184 C; 166 G; 163 T; 0 other;
     gaggaggtga acacaatctt aggcattcat gataactaca aacccgactt ctacaatgat        60
     gattcttggg tcgagttcat tgagctagat attgatgacg cagatgcgga tgaaaagact       120
     gaagggtccg acacagacag acttctaagc gatgaccatg agaaatcagc cagtatcctt       180
     ggagcaaagg atgatgactc tggacgtacc agctgttatg accctgacat tttagatact       240
     gatttccaca ccagtgacat atgtgatggt acctcggagt ttgctcagcc acagaagtta       300
     aaagcggaag ctgatctctt gtgccttgac cagaagaatc tgaagaactc gccttatgag       360
     acgtcccttg actctctgca cccctccatt accctgacag tggaagacaa gccacagcca       420
     cttctgggca gtgaaactga gtcaacctac caactcgctt ctacaccggt gagcaatccc       480
     acgtcactgg caaacattga cttttatgct caagtaagtg acattacacc agcaggtggt       540
     gtagtccttt ccccaggcca aaagattaaa gcagggatag cccagggcaa cacccagccg       600
     gaggtggcca caccctgcca agaaaattac agtatgaaca gtgcctactt ctgtgagtca       660
     gatgtcaaaa agtgcatcgc tgtagcccca cgcatggacg ccacgtcatg tgtaaaacca       720
     agcttt                                                                  726
//


spacer
spacer