spacer

EBI Dbfetch

ID   DQ019059; SV 1; linear; genomic DNA; STD; ROD; 847 BP.
XX
AC   DQ019059;
XX
DT   17-OCT-2005 (Rel. 85, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Hybomys univittatus growth hormone receptor (ghr) gene, exon 10 and partial
DE   cds.
XX
KW   .
XX
OS   Hybomys univittatus (Peter's striped mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Hybomys.
XX
RN   [1]
RP   1-847
RX   DOI; 10.1016/j.ympev.2005.04.016.
RX   PUBMED; 15975830.
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   "Multigene phylogeny of the Old World mice, Murinae, reveals distinct
RT   geographic lineages and the declining utility of mitochondrial genes
RT   compared to nuclear genes";
RL   Mol. Phylogenet. Evol. 37(2):370-388(2005).
XX
RN   [2]
RP   1-847
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   ;
RL   Submitted (26-APR-2005) to the INSDC.
RL   Pediatrics, University of Tennessee Health Science Center, 50 North Dunlap,
RL   308 West Patient Tower, Memphis, TN 38103, USA
XX
DR   MD5; 167c3c5d1ee11eb0ab67cc2ca0c20d1f.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..847
FT                   /organism="Hybomys univittatus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:71162"
FT   gene            <1..>847
FT                   /gene="ghr"
FT   mRNA            <1..>847
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>847
FT                   /codon_start=3
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q38S88"
FT                   /protein_id="AAY83854.1"
FT                   /translation="FIELDIDDVDEKTEGSDTDRLLSDDHEKSAGILGAKDDDSGRTSC
FT                   YDPDILDTDFHTTDMCDGTSEFAQPQKLNEEADLLCLDQKNLKNSPYDASLGSLHPSIT
FT                   LTEGDQPRSLLGSETESTHQLTSTPISNPVSLANIDFYAQVSDITPAGGVVLSPGQKIK
FT                   AGIAQGNTQPEVATPCQENYSXNSAYFCESDAKKCITVAPCMEATSCVKPSFNQEDIYI
FT                   TTESLSTTPRMSETADTAPDAEMPVPDYTTVHTVQSPRGLILNATALPLPDKKKFLSSW
FT                   A"
FT   exon            <1..>847
FT                   /gene="ghr"
FT                   /number=10
XX
SQ   Sequence 847 BP; 233 A; 223 C; 193 G; 195 T; 3 other;
     agttcattga gctagatatt gatgacgtgg atgagaagac tgaagggtca gacacagaca        60
     gacttctaag tgatgaccat gagaaatcag ctggtatcct tggagcaaag gatgatgatt       120
     ctggacgtac cagctgttat gaccctgaca ttttggatac tgatttccac accactgaca       180
     tgtgtgatgg tacctcagag tttgctcagc cacagaagtt aaatgaggaa gctgatctct       240
     tgtgccttga ccagaagaat ctgaagaact cgccttatga tgcttccctt ggctccctgc       300
     atccctcyat taccctgaca gagggagatc agccacggtc acttttgggc agtgaaactg       360
     agtcaacyca ccaactcacc tctacaccaa taagcaatcc cgtgtcactg gcaaacattg       420
     acttttatgc ccaagtaagc gatattacac cagcaggtgg tgtagtgctt tccccaggcc       480
     aaaagattaa ggcagggata gcccagggca acacccagcc ggaggtggcc actccctgcc       540
     aagagaatta cagcrtgaac agtgcctact tctgtgagtc agatgccaaa aagtgcatca       600
     ctgtggcccc ttgcatggag gccacgtcat gtgtaaaacc aagctttaac caagaggaca       660
     tttacatcac cacagaaagc ctttccacta ctccccggat gtccgagaca gcagatactg       720
     ctccagatgc tgagatgcct gtcccagact ataccacggt tcacaccgtc cagtctccaa       780
     ggggcctaat actaaacgcg actgctttgc ctttgcctga caaaaagaag tttctctcct       840
     cgtgggc                                                                 847
//


spacer
spacer