spacer

EBI Dbfetch

ID   DQ019049; SV 1; linear; genomic DNA; STD; ROD; 809 BP.
XX
AC   DQ019049;
XX
DT   17-OCT-2005 (Rel. 85, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Gerbillus gerbillus growth hormone receptor (ghr) gene, exon 10 and partial
DE   cds.
XX
KW   .
XX
OS   Gerbillus gerbillus (lesser Egyptian gerbil)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Gerbillinae; Gerbillus.
XX
RN   [1]
RP   1-809
RX   DOI; 10.1016/j.ympev.2005.04.016.
RX   PUBMED; 15975830.
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   "Multigene phylogeny of the Old World mice, Murinae, reveals distinct
RT   geographic lineages and the declining utility of mitochondrial genes
RT   compared to nuclear genes";
RL   Mol. Phylogenet. Evol. 37(2):370-388(2005).
XX
RN   [2]
RP   1-809
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   ;
RL   Submitted (26-APR-2005) to the INSDC.
RL   Pediatrics, University of Tennessee Health Science Center, 50 North Dunlap,
RL   308 West Patient Tower, Memphis, TN 38103, USA
XX
DR   MD5; b44306aa66a5af5cc572044cf305977d.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..809
FT                   /organism="Gerbillus gerbillus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:298880"
FT   gene            <1..>809
FT                   /gene="ghr"
FT   mRNA            <1..>809
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>809
FT                   /codon_start=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q38S98"
FT                   /protein_id="AAY83844.1"
FT                   /translation="ELDIDDPDEKTEGSDTDRLLSKDHEKSVNILGAKDDDSGRTSCYD
FT                   PEILDTDFHTSDMGDGTSQITQSQKLRAEADLLCLDQKNLKSSPYDASFGSLHPCITLA
FT                   VEEDKPQALVSSETESTHQLASPLTSNPASLANIDFYAQVSDITPAGSVVLSPGQKIKA
FT                   GIAQCNTQPEAAAPCQENYGMNSAYFCESDAKKCIAVAPHVEARSCAKPDFNQEDIYIT
FT                   TESLTTATRMSKTPELAPDAEAPVPDYTAVHTVQSPRGLILNATALPR"
FT   exon            <1..>809
FT                   /gene="ghr"
FT                   /number=10
XX
SQ   Sequence 809 BP; 233 A; 225 C; 184 G; 167 T; 0 other;
     gagctagata ttgatgaccc agatgaaaag actgaagggt cagacacaga cagacttcta        60
     agcaaagacc atgagaaatc agttaatatc cttggagcaa aagacgatga ttccggacgt       120
     accagctgtt atgatcctga aatcttggac actgatttcc acaccagtga catgggtgat       180
     ggtacctcac agattactca gtcacagaag ttaagagcgg aagccgatct cttgtgcctt       240
     gaccagaaga atctaaaaag ctcaccttat gatgcttcct ttggctctct gcacccatgc       300
     attactctag cggtggaaga agataaacca caggcacttg tgagcagtga aactgaatca       360
     acccaccagc tggcctctcc actgacgagc aatcccgctt cacttgctaa cattgacttc       420
     tatgcccaag taagcgatat tacaccagca ggcagtgtag tcctttcccc aggtcagaag       480
     attaaggcag gaatagccca gtgcaacacg cagccagagg cggccgcacc ctgccaagaa       540
     aattacggca tgaatagtgc ctacttctgt gagtcagatg ccaaaaagtg catcgctgtg       600
     gcccctcacg tggaggccag gtcatgtgcg aaaccagact tcaaccagga ggacatttat       660
     atcaccacag aaagccttac cactgccaca cggatgtcca agacaccaga gcttgcccca       720
     gacgctgagg cacctgtccc agactacacc gcggttcaca ccgtgcagtc tccacggggc       780
     cttatactca acgcgaccgc tttgcctcg                                         809
//


spacer
spacer