spacer

EBI Dbfetch

ID   DQ019048; SV 1; linear; genomic DNA; STD; ROD; 897 BP.
XX
AC   DQ019048;
XX
DT   17-OCT-2005 (Rel. 85, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Desmodillus auricularis growth hormone receptor (ghr) gene, exon 10 and
DE   partial cds.
XX
KW   .
XX
OS   Desmodillus auricularis (Cape short-eared gerbil)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Gerbillinae; Desmodillus.
XX
RN   [1]
RP   1-897
RX   DOI; 10.1016/j.ympev.2005.04.016.
RX   PUBMED; 15975830.
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   "Multigene phylogeny of the Old World mice, Murinae, reveals distinct
RT   geographic lineages and the declining utility of mitochondrial genes
RT   compared to nuclear genes";
RL   Mol. Phylogenet. Evol. 37(2):370-388(2005).
XX
RN   [2]
RP   1-897
RA   Steppan S.J., Adkins R.M., Spinks P.Q., Hale C.;
RT   ;
RL   Submitted (26-APR-2005) to the INSDC.
RL   Pediatrics, University of Tennessee Health Science Center, 50 North Dunlap,
RL   308 West Patient Tower, Memphis, TN 38103, USA
XX
DR   MD5; 2b5aaba49738fe32ce89eccdf3c9cdc3.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..897
FT                   /organism="Desmodillus auricularis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:298896"
FT   gene            <1..>897
FT                   /gene="ghr"
FT   mRNA            <1..>897
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>897
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q38S99"
FT                   /protein_id="AAY83843.1"
FT                   /translation="IXDNYKPDFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSKNHEK
FT                   SVSILGAKDDDSGRTSCYDPEILDTDFHTSDMGDGTSEITQSQKLRAEANLLCLDQXNL
FT                   KNSPYDASVGSLHPCITLAGEXXXXXXXXXXXXXXXXXQQAFTPISNPASLANIDFYAQ
FT                   VSDITPAGSVVLSPGQKIKAGIAQCNTQPEVAATCQENYGMNSAYFCESDAKKCIPVAP
FT                   HMEARSCAKPDFNQEDIYITTESLTTTARMSKTTELAPDAELPVPDYTAVHTVQSPRGL
FT                   ILNATALPLPEKKKFLSS"
FT   exon            <1..>897
FT                   /gene="ghr"
FT                   /number=10
XX
SQ   Sequence 897 BP; 251 A; 218 C; 180 G; 199 T; 49 other;
     cattcntgat aactacaaac ctgacttcta caatgatgac tcctgggttg agtttattga        60
     gctagatatt gatgacccag atgaaaagac tgaagggtca gacacagaca gacttctaag       120
     caaaaaccat gagaaatcgg ttagtatcct tggagcaaag gatgatgatt ctggacgtac       180
     tagctgttat gaccctgaaa ttttggacac tgatttccac accagtgaca tgggtgatgg       240
     tacctcagag attactcagt cacagaagtt aagagcagaa gccaatctct tgtgccttga       300
     ccagaanaat ctaaaaaact cgccttatga tgcttctgtt ggctctctgc acccctgcat       360
     taccctagca ggagaagann nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnaccaa caagccttta caccaataag caatcctgct tcacttgcta acattgactt       480
     ttatgcccaa gtaagcgata ttacaccagc aggcagtgta gtcctttccc caggtcaaaa       540
     gattaaggca ggaatagccc agtgcaacac gcagccagag gtggccgcaa cctgccaaga       600
     aaattacggc atgaacagtg cctacttctg tgagtcagat gccaaaaagt gcatccctgt       660
     ggcccctcac atggaggcca ggtcatgtgc aaaaccagac tttaaccagg aggacattta       720
     tatcaccaca gaaagcctta ccactactgc acggatgtcc aagacaacag agcttgctcc       780
     agatgctgag ttgcctgtcc cagactacac tgcggttcac accgtgcagt ctccacgggg       840
     ccttatactc aacgcgactg ctttgccttt gcctgagaaa aagaagttcc tctcctc          897
//


spacer
spacer