spacer

EBI Dbfetch

ID   DQ007939; SV 1; linear; genomic DNA; STD; HUM; 993 BP.
XX
AC   DQ007939;
XX
DT   07-MAY-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1802 allele, exons 1
DE   through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-993
RX   DOI; 10.1111/j.1399-0039.2005.00503.x.
RX   PUBMED; 16451205.
RA   Hou L., Tu B., Ling G., Tang T., Cao K., Steiner N.K., Lazaro A., Ng J.,
RA   Hartman R.J., Hurley C.K.;
RT   "Strategies for evaluating B*18 allelic diversity by sequence-based typing
RT   applied to studies of a population from Singapore and African-Americans";
RL   Tissue Antigens 67(1):66-69(2006).
XX
RN   [2]
RP   1-993
RA   Lazaro A.M., Hou L., Hurley C.K.;
RT   ;
RL   Submitted (14-APR-2005) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., N.W., E404, New
RL   Research Building, Washington, DC 20007, USA
XX
DR   MD5; b5913f5706117be52cc9cb55e0a16f8e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..993
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00059"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>993
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1802"
FT   mRNA            join(<1..73,202..471,718..>993)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1802"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,202..471,718..>993)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1802"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q4ZHV9"
FT                   /db_xref="IMGT/HLA:B*18:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZHV9"
FT                   /protein_id="AAY25029.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQNMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1802"
FT                   /number=1
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1802"
FT                   /number=2
FT   exon            718..993
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1802"
FT                   /number=3
XX
SQ   Sequence 993 BP; 166 A; 331 C; 369 G; 127 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct ccttgcccca ggctcccact ccatgaggta tttccacacc tccgtgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacggc acccagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga ggacggagcc ccgggcgccg tggatagagc       360
     aagaggggcc ggagtattgg gaccggaaca cacagatctc caagaccaac acacagactt       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cccccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggga cggggctgac cgcggggccg gggccagggt       720
     ctcacaccct ccagaatatg tatggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcatgacca gtccgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     tggcggagca gctgagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagacacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgg                                    993
//


spacer
spacer