spacer

EBI Dbfetch

ID   AH014850; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH014850; DQ003052-DQ003053;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*06202 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Oh H.B., Hur S.S., Lee M.N., Park S.Y., Kwon O.J.;
RT   "Novel HLA-Cw*06 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Oh H.B., Hur S.S., Lee M.N., Park S.Y., Kwon O.J.;
RT   ;
RL   Submitted (07-APR-2005) to the INSDC.
RL   Molecular Genetics, BioSewoom Institute of Bioscience & Biotechnology,
RL   Wooyoung Technocenter 1F, #273-15, Sungsu 2-Ga 3-Dong, Sungdong-Gu, Seoul
RL   133-831, Republic of Korea
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:62948016, gi:62948017, gi:62948015.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*06202 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*06202 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*06202 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q4ZJJ0"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZJJ0"
FT                   /protein_id="AAY23010.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQWMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARETEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*06202 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*06202 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 107 A; 170 C; 199 G; 70 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccc cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgagacgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer