spacer

EBI Dbfetch

ID   D89918; SV 1; linear; genomic DNA; STD; HUM; 219 BP.
XX
AC   D89918;
XX
DT   24-FEB-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC gene for DRB40101102N, partial cds.
XX
KW   DRB4*0101102N; HLA DRB4.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-219
RA   Hidetoshi I.;
RT   ;
RL   Submitted (17-DEC-1996) to the INSDC.
RL   Inoko Hidetoshi, Tokai Univ. school of med., Derpt. Molecular Life Science;
RL   Bohseidai, Isehara, Kanagawa 259-11, Japan
RL   (E-mail:tnaruse@is.icc.u-tokai.ac.jp, Tel:0463-93-1121, Fax:0463-94-8884)
XX
RN   [2]
RP   1-219
RX   DOI; 10.1111/j.1399-0039.1997.tb02729.x.
RX   PUBMED; 9062971.
RA   Naruse T.K., Andoh R., Nose Y., Kagiya M., Andoh H., Kawata H., Nabeya N.,
RA   Isshiki G., Inoko H.;
RT   "HLA-DRB4 genotyping by PCR-RFLP: diversity in the associations between
RT   HLA-DRB4 and DRB1 alleles";
RL   Tissue Antigens 49(2):152-159(1997).
XX
DR   MD5; bcaa01649cb88a4bda1c981b6407ea0b.
DR   Ensembl-Gn; ENSG00000227357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231021; homo_sapiens.
DR   Ensembl-Tr; ENST00000411565; homo_sapiens.
DR   Ensembl-Tr; ENST00000457451; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..219
FT                   /organism="Homo sapiens"
FT                   /isolate="DRB4"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DBB"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>219
FT                   /codon_start=2
FT                   /gene="HLA DRB4"
FT                   /product="DRB4*0101102N"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:01:02N"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:O00664"
FT                   /protein_id="BAA14037.1"
FT                   /translation="KTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQ
FT                   NGDWTFQTLVMLETVPRSGEVYTCQVE"
XX
SQ   Sequence 219 BP; 52 A; 57 C; 67 G; 43 T; 0 other;
     aaagacccag cccctgcagc accacaacct cctggtctgc tctgtgaatg gtttctatcc        60
     aggcagcatt gaagtcaggt ggttccggaa cggccaggaa gagaaggctg gggtggtgtc       120
     cacaggcctg atccagaatg gagactggac cttccagacc ctggtgatgc tggaaacagt       180
     tcctcggagt ggagaggttt acacctgcca agtggagca                              219
//


spacer
spacer