Dbfetch

ID   D89917; SV 1; linear; genomic DNA; STD; HUM; 169 BP.
XX
AC   D89917;
XX
DT   24-FEB-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC gene for DRB1*09012, partial cds.
XX
KW   DRB1*09012; HLA DRB1.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-169
RA   Naruse T.K.;
RT   ;
RL   Submitted (17-DEC-1996) to the INSDC.
RL   Taeko K Naruse, Tokai Univ,School of Med., Dept. Molecular Life Science;
RL   Bohseidai, Isehara, kanagawa 259-11, Japan
RL   (E-mail:tnaruse@is.icc.u-tokai.ac.jp, Tel:0463-93-1121, Fax:0463-94-8884)
XX
RN   [2]
RP   1-169
RX   DOI; 10.1111/j.1399-0039.1997.tb02729.x.
RX   PUBMED; 9062971.
RA   Naruse T.K., Andoh R., Nose Y., Kagiya M., Andoh H., Kawata H., Nabeya N.,
RA   Isshiki G., Inoko H.;
RT   "HLA-DRB4 genotyping by PCR-RFLP: diversity in the associations between
RT   HLA-DRB4 and DRB1 alleles";
RL   Tissue Antigens 49(2):152-159(1997).
XX
DR   MD5; b6458625f9592c9ff342944b6b88764c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..169
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DR9"
FT                   /cell_line="ISK"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>169
FT                   /codon_start=3
FT                   /gene="HLA DRB1"
FT                   /product="DRB1*09012"
FT                   /db_xref="GOA:Q99938"
FT                   /db_xref="IMGT/HLA:DRB1*09:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q99938"
FT                   /protein_id="BAA20564.1"
FT                   /translation="HRGIYNQEENVRFDDVGEYRAVTELGRPVAESWNSQKDFLERRRA
FT                   EVDTVCRHNYG"
FT   exon            <1..>169
FT                   /number=2
XX
SQ   Sequence 169 BP; 38 A; 43 C; 66 G; 22 T; 0 other;
     tgcacagagg catctataac caagaggaga acgtgcgctt cgacgacgtg ggggagtacc        60
     gggcggtgac ggagctgggg cggcctgtcg ccgagtcctg gaacagccag aaggacttcc       120
     tggagcggag gcgggccgag gtggacaccg tgtgcagaca caactacgg                   169
//