spacer

EBI Dbfetch

ID   D89334; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   D89334;
XX
DT   10-DEC-1996 (Rel. 50, Created)
DT   13-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I cell surface glycoprotein, partial
DE   cds, exon 3 region.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Kaneshige T., Inagawa A., Moribe T.;
RT   ;
RL   Submitted (19-NOV-1996) to the INSDC.
RL   Contact:Toshihiko Kaneshige Shionogi & Co., Ltd., Diagnostic Science
RL   Division; 2-5-1 Mishima, Settsu, Osaka 566, Japan
XX
RN   [2]
RA   Inagawa A., Moribe T., Kaneshige T.;
RT   "Identification of novel allele corresponding to serotype B55.2";
RL   Unpublished.
XX
DR   MD5; f90f1b911639cb9df07127cd42f52eb6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I cell surface glycoprotein"
FT                   /note="exon 3 region"
FT                   /note="recombination between HLA-B*4002 and HLA-B*5502 at
FT                   location <135..>142"
FT                   /db_xref="GOA:P79488"
FT                   /db_xref="IMGT/HLA:B*55:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:P79488"
FT                   /protein_id="BAA13946.1"
FT                   /translation="SHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 276 BP; 53 A; 89 C; 100 G; 34 T; 0 other;
     ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer