spacer

EBI Dbfetch

ID   D89333; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   D89333;
XX
DT   10-DEC-1996 (Rel. 50, Created)
DT   13-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens HLA-B gene for MHC class I cell surface glycoprotein, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kaneshige T., Inagawa A., Moribe T.;
RT   ;
RL   Submitted (19-NOV-1996) to the INSDC.
RL   Contact:Toshihiko Kaneshige Shionogi & Co., Ltd., Diagnostic Science
RL   Division; 2-5-1 Mishima, Settsu, Osaka 566, Japan
XX
RN   [2]
RA   Inagawa A., Moribe T., Kaneshige T.;
RT   "Identification of novel allele corresponding to serotype B55.2";
RL   Unpublished.
XX
DR   MD5; 3dbc079d336042674941fa4f90c45e33.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I cell surface glycoprotein"
FT                   /note="recombination between HLA-B*5502 and HLA-B*4002 at
FT                   location <220..>270"
FT                   /db_xref="GOA:P79487"
FT                   /db_xref="IMGT/HLA:B*55:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:P79487"
FT                   /protein_id="BAA13945.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEA"
XX
SQ   Sequence 270 BP; 58 A; 85 C; 93 G; 34 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer