spacer

EBI Dbfetch

ID   D85761; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   D85761;
XX
DT   11-FEB-1997 (Rel. 50, Created)
DT   12-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens HLA-B*5504 mRNA for HLA-B55.2, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RA   Bannai M.;
RT   ;
RL   Submitted (03-JUN-1996) to the INSDC.
RL   Contact:Makoto Bannai Japanese Red Cross Tokyo Metropolitan Blood Center,
RL   Department of Research; 1-26-1 Kyonan-cho, Musashino-shi, Tokyo 180, Japan
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.1997.tb02765.x.
RX   PUBMED; 9151389.
RA   Bannai M., Tokunaga K., Tanaka H., Lin L., Kashiwase K., Tokunaga K.,
RA   Juji T.;
RT   "Five HLA-B22 group alleles in Japanese";
RL   Tissue Antigens 49(4):376-382(1997).
XX
DR   MD5; ee4524802a8d6ad572bdb596798757e5.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="Kaneko 11840"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /haplotype="HLA-A11.1/A26, HLA-B55.2/B1501, HLA-Cw9"
FT                   /dev_stage="adult"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /note="Japanese"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B*5504"
FT                   /product="HLA-B55.2"
FT                   /note="one of HLA-B22 group alleles in Japanese accepted by
FT                   WHO Nomenclature Comittee"
FT                   /db_xref="GOA:P30493"
FT                   /db_xref="H-InvDB:HIT000101902.14"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*55:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30493"
FT                   /protein_id="BAA12868.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1089 BP; 222 A; 339 C; 360 G; 168 T; 0 other;
     atgcgggtca cggcaccccg aaccctcctc ctgctgctct ggggggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc tacaaggccc aggcacagac tgaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     agcatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer