spacer

EBI Dbfetch

ID   D83031; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   D83031;
XX
DT   07-SEP-1998 (Rel. 56, Created)
DT   26-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-Cw*1502 mRNA for MHC class I antigen, complete cds.
XX
KW   HLA-Cw*1502; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RA   Wang H.;
RT   ;
RL   Submitted (10-JAN-1996) to the INSDC.
RL   Contact:Huiru Wang Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan
XX
RN   [2]
RA   Wang H., Tokunaga K.;
RT   "HLA-C locus polymorphisms in Japanese";
RL   Unpublished.
XX
DR   MD5; e085060237b6fb10d7e21521d020295c.
DR   Ensembl-Gn; ENSG00000206435; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206452; homo_sapiens.
DR   Ensembl-Tr; ENST00000400341; homo_sapiens.
DR   Ensembl-Tr; ENST00000400394; homo_sapiens.
DR   H-InvDB; HIT000101784_03.4.
DR   H-InvDB; HIT000101784_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="KUE"
FT                   /mol_type="mRNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /note="genotype:A24/A11.1, B5.35/B67,C7/C-"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-Cw*1502 allele"
FT                   /db_xref="GOA:Q07000"
FT                   /db_xref="H-InvDB:HIT000101784_02.4"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*15:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07000"
FT                   /protein_id="BAA32614.1"
FT                   /translation="MRVMTPRTLLLLLSGALALTETWACSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQTDRVNLRK
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQLAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 1101 BP; 221 A; 337 C; 369 G; 174 T; 0 other;
     atgcgggtca tgacgccccg aaccctcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttctaca ccgctgtgtc ccggcccggc       120
     cgcggagagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc aagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaac tacaagcgcc aggcacagac tgaccgagtg       300
     aacctgcgga aactgcgcgg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggca tgaccagtta       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atgggagcca       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt gatggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//


spacer
spacer