Dbfetch

ID   D78000; SV 2; linear; genomic DNA; STD; HUM; 1170 BP.
XX
AC   D78000; D77998-D77999;
XX
DT   26-SEP-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 12)
XX
DE   Homo sapiens gene for HLA-G*GJ1, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1170
RA   Yamashita T.;
RT   ;
RL   Submitted (19-OCT-1995) to the INSDC.
RL   Takahiro Yamashita, Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan (Tel:03-5485-6009,
RL   Fax:03-3406-7892)
XX
RN   [2]
RX   DOI; 10.1007/s002510050110.
RX   PUBMED; 8662085.
RA   Yamashita T., Fujii T., Watanabe Y., Tokunaga K., Tadokoro K., Juji T.,
RA   Taketani Y.;
RT   "HLA-G gene polymorphism in a Japanese population";
RL   Immunogenetics 44(3):186-191(1996).
XX
DR   MD5; dcba77e13f10ff7d4caf83ee4def5851.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1170
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="YRK"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..17
FT                   /number=1
FT                   /note="3'portion of exon 1"
FT   CDS             join(<18..287,434..709,875..>1150)
FT                   /codon_start=3
FT                   /product="HLA-G*GJ1"
FT                   /db_xref="IMGT/HLA:G*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q95356"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="BAA11185.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGED
FT                   QTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRW"
FT   exon            18..287
FT                   /number=2
FT   intron          288..>325
FT                   /number=2
FT                   /note="5'portion of exon 2"
FT   gap             326..425
FT                   /estimated_length=unknown
FT   intron          <426..433
FT                   /number=2
FT                   /note="3'portion of intron 2"
FT   exon            434..709
FT                   /number=3
FT   intron          710..>749
FT                   /number=3
FT                   /note="5'portion of intron 3"
FT   gap             750..849
FT                   /estimated_length=unknown
FT   intron          <850..874
FT                   /number=3
FT                   /note="3'portion of exon 3"
FT   exon            875..1150
FT                   /number=4
FT   intron          1151..>1170
FT                   /number=4
FT                   /note="5'portion of intron 4"
XX
SQ   Sequence 1170 BP; 198 A; 290 C; 328 G; 154 T; 200 other;
     cccctcctcg cccccaggct cccactccat gaggtatttc agcgccgccg tgtcccggcc        60
     cggccgcggg gagccccgct tcatcgccat gggctacgtg gacgacacgc agttcgtgcg       120
     gttcgacagc gactcggcgt gtccgaggat ggagccgcgg gcgccgtggg tggagcagga       180
     ggggccggag tattgggaag aggagacacg gaacaccaag gcccacgcac agactgacag       240
     aatgaacctg cagaccctgc gcggctacta caaccagagc gaggccagtg agtaactccg       300
     gcccagggag cagatcacga cccccnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnggggc caggttctca caccctccag tggatgattg gctgcgacct ggggtccgac       480
     ggacgcctcc tccgcgggta tgaacagtat gcctacgatg gcaaggatta cctcgccctg       540
     aacgaggacc tgcgctcctg gaccgcagcg gacactgcgg ctcagatctc caagcgcaag       600
     tgtgaggcgg ccaatgtggc tgaacaaagg agagcctacc tggagggcac gtgcgtggag       660
     tggctccaca gatacctgga gaacgggaag gagatgctgc agcgcgcggg taccaggggc       720
     agtggggcgc ctccctgatc tcctgtagan nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnt gaattttctg actcttcctt tcagaccccc ccaagacaca cgtgacccac       900
     caccctgtct ttgactatga ggccaccctg aggtgctggg ccctgggctt ctaccctgcg       960
     gagatcatac tgacctggca gcgggatggg gaggaccaga cccaggacgt ggagctcgtg      1020
     gagaccaggc ctgcagggga tggaaccttc cagaagtggg cagctgtggt ggtgccttct      1080
     ggagaggagc agagatacac gtgccatgtg cagcatgagg ggctgccgga gcccctcatg      1140
     ctgagatgga gtaaggaggg agatggaggc                                       1170
//