spacer

EBI Dbfetch

ID   D67005; SV 2; linear; genomic DNA; STD; HUM; 1171 BP.
XX
AC   D67005; D67003-D67004;
XX
DT   26-OCT-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Homo sapiens gene for HLA-G*GJ4, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1171
RA   Yamashita T.;
RT   ;
RL   Submitted (21-SEP-1995) to the INSDC.
RL   Takahiro Yamashita, Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan (Tel:03-5485-6009,
RL   Fax:03-3406-7892)
XX
RN   [2]
RX   DOI; 10.1007/s002510050110.
RX   PUBMED; 8662085.
RA   Yamashita T., Fujii T., Watanabe Y., Tokunaga K., Tadokoro K., Juji T.,
RA   Taketani Y.;
RT   "HLA-G gene polymorphism in a Japanese population";
RL   Immunogenetics 44(3):186-191(1996).
XX
DR   MD5; 39907d1105cc317d3295fae3b32a3a36.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1171
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="KKH"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..17
FT                   /number=1
FT                   /note="3'portion of intron 1"
FT   CDS             join(<18..287,435..710,876..>1151)
FT                   /codon_start=3
FT                   /product="HLA-G*GJ4"
FT                   /db_xref="GOA:O19658"
FT                   /db_xref="IMGT/HLA:G*01:01:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19658"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="BAA11031.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGED
FT                   QTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRW"
FT   exon            18..287
FT                   /number=2
FT   intron          288..>326
FT                   /number=2
FT                   /note="5'portion of intron 2"
FT   gap             327..426
FT                   /estimated_length=unknown
FT   intron          <427..434
FT                   /number=2
FT                   /note="3'portion of intron 2"
FT   exon            435..712
FT                   /number=3
FT   intron          713..>750
FT                   /number=3
FT                   /note="5'portion of intron 3"
FT   gap             751..850
FT                   /estimated_length=unknown
FT   intron          <851..876
FT                   /number=3
FT                   /note="3'portion of intron 3"
FT   exon            877..1151
FT                   /number=4
FT   intron          1152..>1171
FT                   /number=4
FT                   /note="5'portion of intron 4"
XX
SQ   Sequence 1171 BP; 196 A; 293 C; 328 G; 154 T; 200 other;
     cccctcctcg cccccaggct cccactccat gaggtatttc agcgccgccg tgtcccggcc        60
     cggccgcggg gagccccgct tcatcgccat gggctacgtg gacgacacgc agttcgtgcg       120
     gttcgacagc gactcggcgt gtccgaggat ggagccgcgg gcgccgtggg tggagcagga       180
     ggggccagag tattgggaag aggagacacg gaacaccaag gcccacgcac agactgacag       240
     aatgaacctg cagaccctgc gcggctacta caaccagagc gaggccagtg agtaaccccg       300
     gcccagggcg cagatcacga ccccccnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnngggg ccaggttctc acaccctcca gtggatgatt ggctgcgacc tggggtccga       480
     cggtcgcctc ctccgcgggt atgaacagta tgcctacgat ggcaaggatt acctcgccct       540
     gaacgaggac ctgcgctcct ggaccgcagc ggacactgcg gctcagatct ccaagcgcaa       600
     gtgtgaggcg gccaatgtgg ctgaacaaag gagagcctac ctggagggca cgtgcgtgga       660
     gtggctccac agatacctgg agaacgggaa ggagatgctg cagcgcgcgg gtaccagggg       720
     cagtggggcg cctccctgat ctcctgtaga nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn tgagttttct gactcttcct ttcagacccc cccaagacac acgtgaccca       900
     ccaccctgtc tttgactatg aggccaccct gaggtgctgg gccctgggct tctaccctgc       960
     ggagatcata ctgacctggc agcgggatgg ggaggaccag acccaggacg tggagctcgt      1020
     ggagaccagg cctgcagggg atggaacctt ccagaagtgg gcagctgtgg tggtgccttc      1080
     tggagaggag cagagataca cgtgccatgt gcagcatgag gggctgccgg agcccctcat      1140
     gctgagatgg agtaaggagg gagatggagg c                                     1171
//


spacer
spacer