spacer

EBI Dbfetch

ID   D64150; SV 1; linear; mRNA; STD; HUM; 895 BP.
XX
AC   D64150;
XX
DT   02-JUN-1996 (Rel. 47, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human mRNA for HLA-Cw*0304, partial cds.
XX
KW   HLA-Cw*0304; MHC class I; MHC class I antigen HLA-Cw*0304.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-895
RA   Wang H.;
RT   ;
RL   Submitted (16-SEP-1995) to the INSDC.
RL   Huiru Wang, Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan (Tel:03-5485-6009,
RL   Fax:03-3406-7892)
XX
RN   [2]
RA   Wang H., Tokunaga K.;
RT   "HLA-C locus polymorphisms in Japanese";
RL   Unpublished.
XX
DR   MD5; 30a2577929f1b2e5a0b4bd4cafb72dc2.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000419135; homo_sapiens.
DR   Ensembl-Tr; ENST00000429840; homo_sapiens.
DR   Ensembl-Tr; ENST00000433153; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..895
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="SKA"
FT                   /mol_type="mRNA"
FT                   /haplotype="A2,26.4; B35,3901; C7,-; DR8.1,8.2; DQ1,3
FT                   A33,26.3; B39.2,60; Cw7,10; DR9,11; DQ7,-; DP2.1,3"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>895
FT                   /codon_start=1
FT                   /product="HLA-Cw*0304"
FT                   /note="HLA-Cw*0304 exon 1-4"
FT                   /db_xref="GOA:O19653"
FT                   /db_xref="H-InvDB:HIT000101709.7"
FT                   /db_xref="IMGT/HLA:C*03:04:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19653"
FT                   /protein_id="BAA19535.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRW"
XX
SQ   Sequence 895 BP; 180 A; 274 C; 312 G; 129 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgctgtgtc ccggcccggc       120
     cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacgt ggggcccgac gggcgcctcc tccgcgggta tgaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggatc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgaa gaatgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagtggg atggggagga ccaaactcag gacactgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atggg            895
//


spacer
spacer