Dbfetch

ID   D64147; SV 1; linear; mRNA; STD; HUM; 895 BP.
XX
AC   D64147;
XX
DT   02-JUN-1996 (Rel. 47, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens mRNA for HLA-Cw*0602, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-895
RA   Wang H.;
RT   ;
RL   Submitted (16-SEP-1995) to the INSDC.
RL   Huiru Wang, Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan (Tel:81-3-5485-6009,
RL   Fax:81-3-3406-7892)
XX
RN   [2]
RA   Wang H., Tokunaga K.;
RT   "HLA-C locus polymorphisms in Japanese";
RL   Unpublished.
XX
DR   MD5; b141cc845113d41d5c3eadffe0e2eced.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..895
FT                   /organism="Homo sapiens"
FT                   /isolate="TTU"
FT                   /mol_type="mRNA"
FT                   /haplotype="A1,24; B7,37; C6,7"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>895
FT                   /codon_start=1
FT                   /product="HLA-Cw*0602"
FT                   /note="HLA-Cw6 exon 1-4"
FT                   /note="MHC class I"
FT                   /db_xref="H-InvDB:HIT000101706.9"
FT                   /db_xref="IMGT/HLA:C*06:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:O19657"
FT                   /protein_id="BAA19533.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRW"
XX
SQ   Sequence 895 BP; 180 A; 282 C; 309 G; 124 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttcgaca ccgccgtgtc ccggcccggc       120
     cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccccgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc tgaccgagtg       300
     aacctgcgga aactgcgcgg ctactacaac cagagcgagg acgggtctca caccctccag       360
     tggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagtgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccagagcccc tcaccctgag atggg            895
//