spacer

EBI Dbfetch

ID   D64145; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   D64145;
XX
DT   08-JUN-1996 (Rel. 48, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens mRNA for HLA-Cw*0103, complete cds.
XX
KW   HLA-Cw*0103; MHC class I.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RA   Wang H.;
RT   ;
RL   Submitted (16-SEP-1995) to the INSDC.
RL   Huiru Wang, Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan (Tel:03-5485-6009,
RL   Fax:03-3406-7892)
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.1998.tb02995.x.
RX   PUBMED; 9672159.
RA   Wang H., Nakajima F., Tokunaga K., Kashiwase K., Ishikawa Y., Juji T.;
RT   "Cw*0103, a new allele encoding for a novel HLA-Cw1 split in the Japanese
RT   population";
RL   Tissue Antigens 51(5):571-573(1998).
XX
DR   MD5; 2a213685bfe087068ce96fe313585fd6.
DR   Ensembl-Gn; ENSG00000237022; homo_sapiens.
DR   Ensembl-Tr; ENST00000438171; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="ITOU"
FT                   /mol_type="mRNA"
FT                   /haplotype="A24AK,33; B46,44; Cw1,-; DR9,13; DQ3,1"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /product="HLA-Cw*0103"
FT                   /note="HLA-CW1N exon 1-8"
FT                   /db_xref="GOA:P30499"
FT                   /db_xref="H-InvDB:HIT000101704.14"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30499"
FT                   /protein_id="BAA19531.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMKYFFTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQWMCGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVMVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 1101 BP; 214 A; 336 C; 373 G; 178 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgctccca ctccatgaag tatttcttca catccgtgtc ccggcctggc       120
     cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     tggatgtgtg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagcgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagtggg atggggagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtgatggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt ggtggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//


spacer
spacer