spacer

EBI Dbfetch

ID   D50853; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   D50853;
XX
DT   07-SEP-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-Cw*0303 mRNA for MHC class I antigen, complete cds.
XX
KW   HLA-Cw*0303; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RA   Wang H.;
RT   ;
RL   Submitted (02-JUN-1995) to the INSDC.
RL   Huiru Wang, Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-ku, Tokyo 150, Japan (Tel:03-5485-6009,
RL   Fax:03-3406-7892)
XX
RN   [2]
RA   Wang H., Tokunaga K., Kuwata S.;
RT   "DNA typing of HLA-C locus alleles in Japanese";
RL   Unpublished.
XX
DR   MD5; 56e597cedcde50bc3217319b093420d2.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="SJK"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /note="genotype:A2/A-,B39/B62,C7/C9,DR15/DR-,DQ1/DQ-"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-Cw*0303 allele"
FT                   /db_xref="GOA:P04222"
FT                   /db_xref="H-InvDB:HIT000101642.14"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*03:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1EFX"
FT                   /protein_id="BAA32610.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEARSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 1101 BP; 216 A; 330 C; 377 G; 178 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgctgtgtc ccggcccggc       120
     cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccaggtctca catcatccag       360
     aggatgtatg gctgcgacgt ggggcccgac gggcgcctcc tccgcgggta tgaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggatc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgaa gaatgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagtggg atggggagga ccaaactcag gacactgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt ggtggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//


spacer
spacer